SKU: 13681132208

Rat IgG kappa A, His tag

Sale price$101.25 Regular price$112.50
Save 10%

Pay in installments of $28.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 27 - Aug 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat IgG kappa A, His tagProduct Specification Species Rat Synonyms Ig kappa chain C region, A allele Accession P01836 Amino Acid Sequence Protein sequence (P01836, Ala1 Cys106, with C 10*His) ADAAPTVSIFPPSMEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNRNECGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 13. 4 kDa Observed MW: 15, 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Rat
Synonyms Ig kappa chain C region, A allele
Accession P01836
Amino Acid Sequence

Protein sequence (P01836, Ala1-Cys106, with C-10*His) ADAAPTVSIFPPSMEQLTSGGATVVCFVNNFYPRDISVKWKIDGSEQRDGVLDSVTDQDSKDSTYSMSSTLSLTKVEYERHNLYTCEVVHKTSSSPVVKSFNRNECGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 13.4 kDa Observed MW: 15, 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Immunoglobulin G (IgG) is a type of antibody. IgG molecules are created and released by plasma B cells. Each IgG antibody has two paratopes. Antibodies are major components of humoral immunity. IgG is the main type of antibody found in blood and extracellular fluid, allowing it to control infection of body tissues. By binding many kinds of pathogens such as viruses, bacteria, and fungi, IgG protects the body from infection. IgG antibodies are large globular proteins made of four peptide chains; two identical γ (gamma) heavy chains of about 50 kDa and two identical light chains of about 25 kDa. light chain (L chain) refers to the small molecular weight peptide chain in immunoglobulin. According to its structure and the antigenicity of the constant region, it is divided into two types: kappa light chain and lambda light chain.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13681132208

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
Erika
Louisville, US
★★★★★ 5
My favorite face wash for sensitive skin
Size: 19 Fl Oz (Pack of 1)
I have very sensitive and eczema prone skin and this face wash is the only one that I will use. It is so gentle and it works so well on my skin to remove makeup and anything else. It doesn’t really foam, but it lathers on nicely and a little bit goes a long way. It is really gentle and moisturize my face. It’s not greasy at all and it doesn’t leave any residue behind. Recently, I’ve been wearing a lot of sunscreen went outside with my toddler and I am so impressed by how well it removes that. The bottle is big and lasts a very long time making it such a great value. This is my favorite face wash and I will be using it for many years to come.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
Y
Verified Purchase
Yuliia Kuznetsova
Houston, US
★★★★★ 5
I am really happy with this purchase.😍🤌🏼
Size: 19 Fl Oz (Pack of 1), Size: 19 Fl Oz (Pack of 1)
I’ve been using the CeraVe Hydrating Facial Cleanser for almost half a year now, and it has honestly become a staple in my skincare routine. My skin tends to be dry and sensitive, and this cleanser keeps it feeling soft, clean, and comfortable without drying it out. The formula is very gentle and creamy, and I love that it contains hyaluronic acid, ceramides, and glycerin. After washing my face, my skin feels hydrated and calm instead of tight or irritated. It’s also fragrance-free, which is a huge plus for sensitive skin. Over time, I’ve noticed my skin barrier feels healthier and less reactive, especially during colder or drier weather. It works perfectly for daily use and pairs well with other skincare products without causing breakouts. I also appreciate that it’s certified by the National Eczema Association, which gave me more confidence trying it long term. Overall, this is one of the best gentle cleansers I’ve used, and I’ll definitely continue repurchasing it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
D
Verified Purchase
Don L
Grantham, US
★★★★★ 4
Great for dry skin, but expect a richer and oilier feel
Size: 16 Fl Oz (Pack of 1)
I picked this up after my dermatologist recommended CeraVe for my dry, eczema-prone skin and I'm pretty happy with it. It cleanses gently without stripping any moisture and my skin feels hydrated and calm after every wash — no tightness, no irritation. The hyaluronic acid and ceramides combo is clearly doing something right. That said, if you're switching over from the CeraVe Renewing SA Cleanser like I did, be prepared for a noticeably different texture. The SA Cleanser has a lighter, more gel-like feel whereas this one is significantly richer and has more of an oily texture that can feel a bit heavy, especially if you have combination skin or tend to get oily in your T-zone. For strictly dry skin it's probably perfect, but it took some getting used to for me personally. Still a solid cleanser backed by good ingredients and the National Eczema Association certification gives it extra credibility. Just know what you're getting into texture-wise before making the switch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
J
Verified Purchase
Junior
Belleville, US
★★★★★ 5
Super Gentle, Super Effective — My Skin Finally Feels Normal Again
Size: 19 Fl Oz (Pack of 1)
I’ve tried a bunch of face washes over the years, and most of them left my skin tight, dry, or weirdly irritated. I decided to switch to the CeraVe Hydrating Facial Cleanser after hearing so many good things about it — and honestly, I wish I had bought it sooner. First off, the texture is different from your typical foaming cleanser. It’s more like a creamy gel, which I actually ended up loving. It doesn’t strip your skin or leave that squeaky, dry feeling. Instead, it cleans without ever making my skin feel like it’s being punished. When I rinse it off, my face feels soft, calm, and hydrated — like I actually still have moisture in my skin. The ingredients are what make this thing so legit: hyaluronic acid for hydration, ceramides to repair the skin barrier, and glycerin to lock everything in. It’s fragrance-free, gentle, and literally approved by the National Eczema Association, so you know it’s made for sensitive skin. After using it daily, my skin went from dry and flaky to smooth and balanced. No breakouts, no redness, no random patches of irritation. It’s just a simple, dependable cleanser that does exactly what it’s supposed to do. If you wear sunscreen or light makeup, it removes it without any issues — and without needing two harsh cleanses. If you’re someone with normal to dry skin, sensitive skin, or you just want a face wash that won’t mess up your moisture barrier, this is hands-down one of the best options out there. It’s gentle, effective, and honestly makes washing your face feel like part of taking care of yourself rather than a chore. Highly recommend — it’s one of those products you buy once and immediately understand why everyone loves it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025
R
Verified Purchase
Rachel Chavez
Battle Creek, US
★★★★★ 5
Effective serum that improves skin texture and hydration
Size: 16 Fl Oz (Pack of 1), Size: 16 Fl Oz (Pack of 1)
I have been using this serum consistently and I can see a clear improvement in my skin. It feels smoother, more hydrated, and more even in texture. It is lightweight, absorbs quickly, and does not irritate my skin. It works well with my other skincare products and I will continue using it. I highly recommend it for anyone looking to improve their skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026

recommand products