Human PIIINP, His Tag
SKU: 10586894026

Human PIIINP, His Tag

Sale price$119.25 Regular price$132.50
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PIIINP, His TagProduct Specification Species Human Synonyms Collagen alpha 1(III) chainCOL3A1 Accession P02461 Amino Acid Sequence Protein sequence (P02461, Gln24 Pro153, with C 10*His) QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 23 30kDa Purity 95% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms Collagen alpha-1(III) chain、COL3A1
Accession P02461
Amino Acid Sequence

Protein sequence (P02461, Gln24-Pro153, with C-10*His) QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 23-30kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

PIIINP is the amino terminal peptide of type III procollagen, released from the precursor peptide during the synthesis and deposition of type III collagen. PIIINP in the serum can be derived from the synthesis of new type III collagen or from the degradation of existing type III collagen fibrils. There is evidence that serum PIIINP measurement is an effective non-invasive test for the detection and monitoring of Methotrexate-induced liver fibrosis and cirrhosis, and serial measurements may reduce the need for liver biopsy. Dermatology patients with repeated normal levels of PIIINP are very unlikely to have significant liver damage from fibrosis or cirrhosis. Conversely a high serum PIIINP or series of high values may indicate that a liver biopsy is required and in some cases, that Methotresate should be withdrawn.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 10586894026

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 649 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amés.
Bozeman, US
★★★★★ 5
Feel like a cloud on the skin. Very gentle and refreshing wipes.
Size: 80 Count (Pack of 3)
I was in need of some wipes to use (for various purposes), and came across this brand. I thought these would be a good choice for me, and decided to order them. I am very appreciative of how nicely these wipes were presented; the wipes were in great shape, and has no leaking or other issues. I ordered the pack of 3, which each has 80 wipes (so, a total of 240 wipes in all). I love how soft and durable these wipes are; these are perfect for changing diapers, or for a quick refresh in the bathroom. Additionally, these could be great for pet wipes as well (in my experience). I love the way the wipes come in these very full and sturdy packs; I love the detailing that went into the design of these wipes. The flip-top is easy to use, and I personally find the cloud shape lid to be adorable. These packs retain their moisture, and each wipes feels very moisturizing and soft. I like how the wipes are larger than the other brands of wipes I've tried in the past. Each wipe is large enough to get a lot done, and has one side that is more textured (great for removing stuck-on messes). These have been very gentle on my skin, as well as my family's. I'm very fond of these Bc Babycare Cloud Moist baby wipes, and would recommend to others. I think these are a nice value, as the packs contain 80 wipes each; wipes are much larger than other brands I've tried (meaning that I don't need to use as many). Great product, and would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 30, 2026
H
Verified Purchase
Holly H McLaughlin
Omaha, US
★★★★★ 5
A good find!
Size: 80 Count (Pack of 3)
This is a really thick pack of wipes. The wipes themselves are thick and textured. You can use one or two and be good to go. A little more pricey but you’re using less wipes for each change. Overall I like them. Good smell and no irritations. They clean well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
K
Verified Purchase
Kristen
Houston, US
★★★★★ 5
Love these
Size: 80 Count (Pack of 3)
I love these for my toddler, they are bigger than regular wipes and have a soft side and a scrubbing side made with raised dots that are still soft on the skin. They are wet enough to do a great job and I like that there is no alcohol. Great value for the price and really sturdy quality. Diaper rash has lessened since we switched to these. I've ordered several times. Easy to use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 20, 2025
W
Verified Purchase
Wendy, NY
Pawtucket, US
★★★★★ 5
Thick and big wipes
Size: 80 Count (Pack of 3)
Great quality and very moist. Great for cleaning up after a baby
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
L
Verified Purchase
lola
Omaha, US
★★★★★ 5
Best wipes I’ve ever used
Size: 10 Count (Pack of 6)
The price was so affordable I thought I might be disappointed. I’ve tried maybe 5 other brands and this is by FAR the best wipes and in perfect packaging for in home and travel use. The wipes are very thick, they do not break for ANYTHING I’m shocked. No fuzzy stringy debris like other wipes I’ve tried. Great for sensitive skin ! Will continue to buy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026

recommand products