Pay in installments of $33.12 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 28 - Sep 2
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human PIIINP, His TagProduct Specification Species Human Synonyms Collagen alpha 1(III) chainCOL3A1 Accession P02461 Amino Acid Sequence Protein sequence (P02461, Gln24 Pro153, with C 10*His) QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 23 30kDa Purity 95% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance
Product Specification
| Species | Human |
| Synonyms | Collagen alpha-1(III) chain、COL3A1 |
| Accession | P02461 |
| Amino Acid Sequence | Protein sequence (P02461, Gln24-Pro153, with C-10*His) QQEAVEGGCSHLGQSYADRDVWKPEPCQICVCDSGSVLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGQGPQGPKGDPGPPGIPGRNGDPGIPGQPGSPGSPGPPGICESCPTGPQNYSPGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 23-30kDa |
| Purity | >95% by SDS-PAGE |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 ℃to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
PIIINP is the amino terminal peptide of type III procollagen, released from the precursor peptide during the synthesis and deposition of type III collagen. PIIINP in the serum can be derived from the synthesis of new type III collagen or from the degradation of existing type III collagen fibrils. There is evidence that serum PIIINP measurement is an effective non-invasive test for the detection and monitoring of Methotrexate-induced liver fibrosis and cirrhosis, and serial measurements may reduce the need for liver biopsy. Dermatology patients with repeated normal levels of PIIINP are very unlikely to have significant liver damage from fibrosis or cirrhosis. Conversely a high serum PIIINP or series of high values may indicate that a liver biopsy is required and in some cases, that Methotresate should be withdrawn.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy