Human Collagen IV, His Tag
SKU: 57275905679

Human Collagen IV, His Tag

Sale price$99.00 Regular price$110.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Collagen IV, His TagProduct Specification Species Human Accession P02462 Amino Acid Sequence Protein sequence(P02462, Lys28 Lys172, with C 10*His) KGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 28kDa Purity 95% by SDS PAGE Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution

Product Specification


Species Human
Accession P02462
Amino Acid Sequence Protein sequence(P02462, Lys28-Lys172, with C-10*His) KGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVPGMLLKGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 28kDa
Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Collagen typte IV is a type of collagen found primarily in the basal lamina. Mutations to the genes coding for collagen IV lead to Alport syndrome. This will cause thinning and splitting of the glomerular basement membrane. It will present as isolated hematuria, sensorineural hearing loss, and ocular disturbances and is passed on genetically, usually in an X-linked manner. Liver fibrosis and cirrhosis are associated with the deposition of collagen IV in the liver. Serum Collagen IV concentrations correlate with hepatic tissue levels of collagen IV in sugjects with alcoholic liver disease and hepatitis C and fall following successful therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 57275905679

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 1897 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Steven Francis
West Palm Beach, US
★★★★★ 5
A PLACE FOR YOUR HEADSET
Size: Small Storage Area, Size: Small Storage Area
This holder is fantastic, if you have the steel series headset and extra batteries it's perfect you'll love it, but would like to see a white version as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2026
A
Verified Purchase
Amazon Customer
Cuba, US
★★★★★ 2
Not quite right
Size: Small Storage Area
this is "as advertised" but a simple extra ridge of plastic would have made it perfect. the issue people are having with the arctis pro, the thing that makes you want a stand for it, is the base station is a little too light, you can push it when you go to use the knob's integrated button. Issue here is the fit of the base is loose enough, you can still push the base out of the back. So it looks nice, and gives you a place to put the headphones and some other desk clutter, but it doesn't REALLY solve the problem.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026
N
Verified Purchase
Nick
West Palm Beach, US
★★★★★ 3
3D Printed (Not Mentioned) and Base is Way Too Loose
Size: Small Storage Area, Size: Small Storage Area
I bought this to clean up my desk setup for my SteelSeries Nova Pro Wireless, and while it looks decent from a distance, there are two major issues that weren't clear from the product page. First, this is a 3D-printed product. Nowhere in the Amazon description or photos does it state that this is 3D printed. You can clearly see the layer lines and "stair-stepping" on the curves. While I don't mind 3D printing in general, for this price point, I expected a standard injection-molded plastic finish. The product page feels a bit misleading by omitting this detail. Second, the fit is very poor. The "integrated dock" for the GameDAC station doesn't actually lock into place. There is no snap or friction fit; it sits so loosely that you can slide the DAC out of the front or back with the single push of a finger. This makes it feel unstable, especially when you are trying to use the volume dial or swap out batteries. Bottom Line: It’s a nice idea and fits the aesthetic of the headset, but the execution feels like a prototype rather than a finished consumer product. If you're looking for a secure "lock-in" feel for your expensive base station, this isn't it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
D
Verified Purchase
Deek
Waukegan, US
★★★★★ 4
it’s really small in depth
Very difficult to open and watch your finger so you don’t pinch them. Great idea. But too short and length or width so I have to send it back.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2025
N
Nix
Charlottesville, US
★★★★★ 5
Compact and looks nice
I got this drying rack to install on the wall over my tub. It's great because I can just pull it out to air-dry my delicates. I can also open it up and use it as a light table to hold my phone and book if I'm taking a bath - dual-purpose! And the hooks are great to hang bath accessories. The best part is that it tucks in to blend with the bathroom wall. It's a very high-end drying rack.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 5, 2024

recommand products