SKU: 10846696958

Human PRDM1/Blimp1 Protein, His tag

Sale price$195.75 Regular price$217.50
Save 10%

Pay in installments of $54.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PRDM1/Blimp1 Protein, His tagProduct Specification Species Human Synonyms PR domain zinc finger protein 1, BLIMP 1, Beta interferon gene positive regulatory domain I binding factor, PR domain containing protein 1, Positive regulatory domain I binding factor 1 (PRDI BF1; PRDI binding factor 1), BLIMP1 Accession O75626 Amino Acid Sequence Protein sequence (O75626, Lys38 Gln223, with C His tag)

Product Specification


Species Human
Synonyms PR domain zinc finger protein 1, BLIMP-1, Beta-interferon gene positive regulatory domain I-binding factor, PR domain-containing protein 1, Positive regulatory domain I-binding factor 1 (PRDI-BF1; PRDI-binding factor 1), BLIMP1
Accession O75626
Amino Acid Sequence

Protein sequence (O75626, Lys38-Gln223, with C-His tag) KMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRNLLFKYATNSEEVIGVMSKEYIPKGTRFGPLIGEIYTNDTVPKNANRKYFWRIYSRGELHHFIDGFNEEKSNWMRYVNPAHSPREQNLAACQNGMNIYFYTIKPIPANQELLVWYCRDFAERLHYPYPGELTMMNLTQ

Expression System E.coli
Molecular Weight Predicted MW: 23.5 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Liquid
Storage Buffer

Supplied as a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 5% glycerol.

Stability & Storage

12 months from date of receipt, -20℃ as supplied.

Background

PRDM1 (PR domain zinc finger protein 1) is a transcription factor critical for cell fate determination and terminal differentiation. It plays a pivotal role in B cell development, driving mature B cells into antibody-secreting plasma cells while repressing B cell identity genes. Beyond immunity, PRDM1 regulates differentiation in other lineages, such as T cells and epithelial cells, and acts as a tumor suppressor in multiple cancers by inhibiting cell proliferation and inducing apoptosis. Dysregulation of PRDM1 is linked to lymphoid malignancies (e.g., multiple myeloma, diffuse large B-cell lymphoma) and solid tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 10846696958

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Julia
Fort Morgan, US
★★★★★ 5
Very comfortable and safe chair
This executive desk chair is very convenient , for its 90° flip-up armrests can be easily pushed under the desk, perfect for home office. The rubber wheels roll smoothly and quietly on my carpet. It supports up to 275 pounds so it is safe to me . The height-adjustable back with 360° swivel makes me move freely . The curved, padded backrest provides relieve back pressure , also it is very easy to set up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
L
Verified Purchase
Lory Johnson
Fort Morgan, US
★★★★★ 4
Recommend it for all.
Color: Grey, Color: Grey
Very nice chair. One warning…it went together very easily except for the last screw!!! I finally gave up. A neighbor came over and gave up. My daughter came. Over and after much groaning and moaning got that last screw in.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
D
Verified Purchase
Daniel Ivan
West Palm Beach, US
★★★★★ 5
Great for home office
Color: Grey, Color: Grey
This was a great replacement to the chair I use when I work from home, padding is firm and comfortable so I have no issue sitting on it for hours, the arm rest are foldable so is very convenient when my dogs are in co worker duty. Very easy to put together and it feels very firm and stable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
C
Verified Purchase
Carol Ann Everitt
New York, US
★★★★★ 5
Thick seat cushion
Color: Grey
This double-layer seat cushion is so comfortable! Before, my lower back would ache after just an hour on a hard bench, but now I can work in this chair for most of the day without feeling tired. The PU leather has a great texture, looks high-end, and is incredibly easy to maintain—just wipe it down with a cloth when it gets dirty. It feels smooth and breathable. The 360-degree swivel is very smooth, making it convenient to reach for documents in the office. The casters roll quietly and won’t scratch the floor. For anyone who spends a lot of time working at a desk, the comfort level at this price point is absolutely worth it. I highly recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
B
Verified Purchase
Brittany
Massapequa, US
★★★★★ 3
Meh
Color: Black
It's ok. I got it because it looked like it has more cushion and might be more comfortable. Nope. It's the same comfort level as different chairs. My reer still goes numb and gets uncomfortable in this chair. Also, where your arms sit, the chair arms are slightly curved upwards and it causes my chair to be unable to fit under my desk. If they weren't slightly curved, that wouldn't happen. It's just another chair, nothing spectacular.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2026

recommand products