SKU: 11430816819

FABP7 His Tag Protein, Human

Sale price$288.00 Regular price$320.00
Save 10%

Pay in installments of $80.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP7 His Tag Protein, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 7 Accession O15540 Amino Acid Sequence Val2 Ala132, with N terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms Fatty acid binding protein 7
Accession O15540
Amino Acid Sequence Val2-Ala132, with N-terminal 8*His MHHHHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity

>95% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris, 100mM NaCl, pH8.0
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid binding protein 7 (FABP7, alternative names brain FABP (B-FABP), brain lipid-binding protein (BLBP) and mammary derived growth inhibitor-related gene (MRG)). Compared to normal brain tissue and low-grade astrocytomas, FABP7 is up-regulated in glioblastoma, and increased nuclear localization of FABP7 in glioblastoma is associated with EGFR amplification and poorer outcomes. The expression of FABP7 is also linked to enhanced cell motility and migration, with a decreasing docosahexaenoic acid (DHA, [ω-3])-arachidonic acid (AA, [ω-6]) ratio appearing to govern these effects, perturbing the normal, tightly regulated ratio of fatty acids in brain tissue and providing increased substrate for prostaglandins such as PGE2 to promote progression.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 11430816819

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
S. Robson
Charlottesville, US
★★★★★ 5
Good printer
Style: Printer & Inks
It is working well for sublimation. No issues so far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
C
Verified Purchase
claudia
Omaha, US
★★★★★ 5
Easy to assemble and quality
Style: Printer & Inks, Style: Printer & Inks
Using my printer almost everyday since Im starting on a sublimation project and I just love it. The printing quality look good The set up was easy and for now Is working 100%
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
N
Verified Purchase
Nadiagne
Chelsea, US
★★★★★ 5
Great 🥰
Style: Printer & Inks, Style: Printer & Inks
The Epson F170 has been ideal for getting started with sublimation. It's easy to use, prints vibrant and defined colors, and has allowed me to personalize various projects with excellent results. As a beginner, it has given me a lot of confidence to learn and create without complications. I definitely recommend it for anyone starting out in sublimation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
J
Verified Purchase
jesus hernandez
Cuba, US
★★★★★ 5
100% recommended.
Style: Printer & Inks
It is an affordable and nice printer for those how wants to start a sublimation printer business. It’s works so good. I am using it to heat press cellphone case and it works amazing
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
P
Verified Purchase
Pat Traynor
Los Angeles, US
★★★★★ 1
No returns and no support. If it doesn't work properly, too bad.
Style: Printer & Inks, Style: Printer & Inks
I was fairly happy with my Epson ET 2800, but was told that I'd get better colors with the F170. So I bit the bullet. The installation went smoothly and I was printing in short order. It was when I started printing items that had some dark gray that I noticed the problem. It was printing green. I contacted Epson tech support and they answered the phone almost immediately. (And how rare is that??) The woman I spoke with seemed to be familiar with the problem and advised me to modify the printer preferences and change the color correction from "ICM" to "No color correction". Well, it wasn't printing green anymore. Now the grays were brown. At this point, she ran out of ideas and gave me an email address for the second level of tech support and asked if I'd send a photo of the printed fabrics showing the problem. I did. That was over three weeks ago. I've sent a couple of followup emails, but they're ignoring me. But the best news was discovering that there are no returns on this product. I didn't think that was a thing with Amazon and I've never had any problems before. So now the 30-day return window is about to elapse and it appears that I'm stuck with an oversized doorstop. In the photo I'm including with this review, the fabric on the upper-left was printed with my Epson ET 2800. On the upper right, the F170 with ICM color correction. On the bottom, the F170 with no color correction.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 12, 2025

recommand products