SKU: 72282155082

LILRB4/CD85k/ILT3 Fc Chimera Protein, Mouse

Sale price$279.00 Regular price$310.00
Save 10%

Pay in installments of $77.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRB4/CD85k/ILT3 Fc Chimera Protein, MouseProduct Specification Species Mouse Accession Q64281 1 Amino Acid Sequence Gly24 Lys238, with C terminal Human IgG Fc

Product Specification


Species Mouse
Accession Q64281-1
Amino Acid Sequence Gly24-Lys238, with C-terminal Human IgG Fc GHLPKPIIWAEPGSVIAAYTSVITWCQGSWEAQYYHLYKEKSVNPWDTQVPLETRNKAKFNIPSMTTSYAGIYKCYYESAAGFSEHSDAMELVMTGAYENPSLSVYPSSNVTSGVSISFSCSSSIVFGRFILIQEGKHGLSWTLDSQHQANQPSYATFVLDAVTPNHNGTFRCYGYFRNEPQVWSKPSNSLDLMISETKDQSSTPTEDGLETYQKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 65-80kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte immunoglobulin (Ig)-like receptor B4 (LILRB4) is a member of leukocyte Ig-like receptors (LILRs). LILRB4 is encoded in the leukocyte receptor cluster, which is on human chromosome 19q13.4. The structure and function of LILRs are similar to those of other leukocyte receptor cluster receptors, such as killer cell immunoglobulin-like receptors. Leukocyte immunoglobulin-like receptor (LILRB4) is a kind of inhibitory receptor that plays a key role in immune checkpoint pathways. Inhibitory receptors also participate in achieving balance between activating and inhibitory actions to ensure immune responses to pathogens in the immune system. However, they not only protect the host from autoimmune responses, but also preserve peripheral tolerance. LILRB4 also regulates immune responses, and its role in regulating immune responses is mostly controlled by its ligands.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72282155082

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
F
Verified Purchase
Firethorn
Cuba, US
★★★★★ 5
Love ❤️ this product! 100% recommend!
Scent: Collagen, Size: 16 Count (Pack of 1)
My initial encounter with these was until TikTok but I ordered them from Amazon for myself and my daughter for convenience and Prime shipping. There were two choices I think the one is a four-pack and the one I got is a 16 pack. The 16 pack will last you 4 months if you're doing it once a week as instructed. I open the top and two sides when I'm doing it just to have accessibility and to be able to use the remnants liquid in the pack after I'm done applying the facial part I put the liquid in the pack on my neck and chest. They are a little slippery when you take them out. I watched a video on how to apply it and did the bottom part first and then the top part sometimes I have to snip the top part near the nose to get it to fit properly but you don't have to in general. There are three pieces that are left over the two eye pieces and the lip piece. You can put them below your eyes or above your eyes on your brows and then put the mask over them which is what I do. Or you can put them under your eyes and put the mask over them but I find it doesn't absorb all the way in that location due to the double thickness I guess. The lip one you can put over your lip or put it on vertically over your throat where the skin can get a little saggy. Once you have it on it's best to sit back and relax for 30 minutes or so at about a 45° angle so it doesn't slip off. After about 10 to 15 minutes it doesn't slip around as much and after 30 it's obviously started absorbing and tends to stay pretty well. I haven't noticed any staining on the pillows or anything like that from it and by morning actually by 4 hours later it's completely absorbed and all you have left on your faces the plastic that it was attached to. You just pull that off and throw it away. It's white when you put it on and it's clear when it absorbs. I definitely noticed an improvement in my skin quality and the collagen sinks in easily and less about a week. I am a redhead with delicate skin and I haven't had any reaction to this product at all I know that other masks have caused problems for friends but I've used this one for over a year now and I love it. My daughter and I both use it weekly and they're easy to take with you if you're traveling great way to pamper your skin after a day outside on the beach. The price is reasonable for what it is and what it does. I've gotten several compliments on my skin and I'm over 60 so that saying something for the results! All in all this is a very good product, it doesn't smell and doesn't seem to have any impurities like some others. My skin isn't irritated by it and looks great afterwards. If you're wondering if it washes off once it's soaked in you can wash your face all you want but you're just going to have beautiful glowing cheeks. I wouldn't hesitate to recommend this or give it as a gift!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2025
K
Verified Purchase
Kevin
Louisville, US
★★★★★ 5
Strong but Effective—Great Results if You Don’t Overdo It (Your Skin Will Warn You 😅)
Size: 8.11 Fl Oz (Pack of 1)
I’ve been using this glycolic acid toner for a few weeks now, and I have to say—my skin and I are finally on better terms. I originally bought it to deal with uneven texture and those random little bumps that seem to show up uninvited, and it’s actually made a noticeable difference. Within the first week, my skin felt smoother, and after a few weeks, I started seeing improvements in tone and dark spots. The quality is pretty impressive. It has a lightweight, watery texture that absorbs quickly and doesn’t feel heavy or sticky. There’s a slight tingling sensation at first, which can be a little surprising—but nothing too crazy. Think of it as your skin saying, “Okay, something is definitely happening here.” That said, this stuff is strong. I made the mistake of using it too often at first and my skin basically said, “Absolutely not.” Lesson learned—use it a few times a week, not every day (unless you enjoy living dangerously). Also, sunscreen is non-negotiable unless you want to undo all your progress. One thing I really like is the versatility—you can use it on other areas like underarms or back, which is a nice bonus. And when it comes to value for the money, it’s honestly great. The bottle is pretty big, and since you don’t need much per use, it lasts a long time. Overall, I’d say this is a high-quality product that actually delivers results—as long as you respect it. Treat it right, and it’ll treat your skin right… ignore the instructions, and it will humble you real quick.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
N
Verified Purchase
Noelle Rogers
San Leandro, US
★★★★★ 5
Game changer! can’t imagine being without it!
Size: 3.4 Fl Oz (Pack of 1)
I’m absolutely delighted with The Ordinary Glycolic Acid 7% Exfoliating Toner! 🌟🌟🌟🌟🌟 This toner has transformed my skincare routine and significantly brightened my complexion. The 7% glycolic acid effectively exfoliates my skin without causing irritation, and I’ve noticed a remarkable improvement in texture and radiance. After just a few uses, my skin feels smoother and looks more even-toned. I love how refreshing it feels upon application, and it absorbs quickly, allowing me to layer my other skincare products without any hassle. The packaging is practical and easy to use, giving just the right amount of product with each application. Plus, the price point is fantastic for such a high-quality product. Overall, I highly recommend The Ordinary Glycolic Acid Toner for anyone looking to brighten their skin and achieve a healthy glow. It’s become a staple in my routine, and I can’t imagine being without it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
N
Verified Purchase
Nafisa
Carnegie, US
★★★★★ 5
The Ordinary Glycolic Acid 7% Review – Effective Glow & Smooth Skin Treatment
Size: 3.4 Fl Oz (Pack of 1)
I really like The Ordinary Glycolic Acid 7% toner. It helps exfoliate the skin and makes it look smoother, brighter, and more even over time. After regular use, my skin feels softer and looks more refreshed. It is also very affordable compared to many other skincare products, and a little goes a long way. The bottle lasts a long time, which makes it good value. However, it can be a bit strong for sensitive skin, so it’s important to start slowly and not overuse it. Also, sunscreen is important because it can make your skin more sensitive to the sun. Overall, it is a very effective exfoliating toner and a great addition to a skincare routine if used correctly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
K
Verified Purchase
Krishayna Miller
Lexington, US
★★★★★ 5
Powerhouse
Size: 8.11 Fl Oz (Pack of 1)
The Ordinary Glycolic Acid has become one of my favorite skincare products. It makes my skin feel smoother, brighter, and much softer after consistent use. I’ve noticed improvement in dullness, rough texture, and even areas like my neck and scalp. A little goes a long way, and the bottle lasts forever for the price. I also love that it’s multi-use and can be used on more than just the face. You do have to be careful not to overuse it because it’s strong, but when used properly it gives amazing results. Such a great affordable skincare staple!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products