SKU: 12543450738

Mouse CD152, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD152, his tagProduct Specification Species Mouse Synonyms Cytotoxic T lymphocyte associated antigen 4 (CTLA 4), Cd152 Accession P09793 Amino Acid Sequence Protein sequence (P09793, Glu36 Asp161, with C 10*His) EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 15. 6 kDa Observed MW: 20 30 kDa Purity 95% by SDS PAGE Tag

Product Specification


Species Mouse
Synonyms Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4), Cd152
Accession P09793
Amino Acid Sequence

Protein sequence (P09793, Glu36-Asp161, with C-10*His) EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 15.6 kDa Observed MW: 20-30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CTLA-4 or CTLA4 (cytotoxic T-lymphocyte-associated protein 4), also known as CD152 (cluster of differentiation 152), is a protein receptor that functions as an immune checkpoint and downregulates immune responses. CTLA-4 is constitutively expressed in regulatory T cells but only upregulated in conventional T cells after activation – a phenomenon which is particularly notable in cancers. It acts as an "off" switch when bound to CD80 or CD86 on the surface of antigen-presenting cells. The CTLA-4 protein is encoded by the Ctla-4 gene in mice and the CTLA-4 gene in humans.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 12543450738

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Amazon Customer
Pawtucket, US
★★★★★ 4
Keeps the Sink Area Neat and Organized
This has been really helpful for keeping my sink area clean. The soap dispenser pumps great! The sponge and brush holders keep everything off the counter so that really helps. The stainless steel looks nice and hasn’t shown any rust so far. It’s compact but holds everything I use daily, and cleaning it is easy. Great little upgrade if your sink area always feels messy. edited to add: took me about 45 minutes to finally get the sticker label off it was stuck directly on the stainless steel so I had to be really careful peelng it off
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 12, 2025
S
SoCoGal
Phoenix, US
★★★★★ 5
Stainless Steel 3-in-1 Sponge/Brush Holder with soap dispenser for Kitchen
This is an ideal item to organize your sink areas. Perfect for kichens but also for bathroom use. I love the built in soap dispenser. The one I currently have doesn't have a dispenser. And the big liquid soap container is always falling over. Mine irack is bigger but this one is more organied. Easy to clean. stainless steel. Smaller foot print so it sits right near the faucet easily. 7.3"L x 5.3"W x 6.5"H And, it has drainage holes in the front rack to keep your sponges fresh by quickly drying. I was going to put this in one of our smaller kitchens in a guest house, but I may just snag it for my kitchen! Good value. Priced right.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 9, 2025
N
Verified Purchase
Nancy
Waukegan, US
★★★★★ 2
Sticky wicket!!
This product arrived as described with one exception. There is a label on the front with a sheer plastic covering which mostly comes off, however the paper and adhesive remaining defy every solvent known to man!!! It has been soaked (twice) in Goo Gone, twice in rubbing alcohol, once in stainless steel cleaner and three times in Dawn power wash.....It remains.... I'd go after it with a razor blade, but I don't want to scratch the stainless.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 14, 2025
J
Verified Purchase
jeanette Rojas
Pawtucket, US
★★★★★ 5
Very practical good quality
Color: Silver
Literal: “Good quality, very functional
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2025
S
Verified Purchase
Susan Jaiy
Belleville, US
★★★★★ 5
Looks nice
Color: Silver
It looks very nice. It has a streamlined design, not big and bulky. Quality is ok. I really like the look of it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 22, 2024

recommand products