SKU: 95554049660

Mouse CD152, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse CD152, his tagProduct Specification Species Mouse Synonyms Cytotoxic T lymphocyte associated antigen 4 (CTLA 4), Cd152 Accession P09793 Amino Acid Sequence Protein sequence (P09793, Glu36 Asp161, with C 10*His) EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 15. 6 kDa Observed MW: 20 30 kDa Purity 95% by SDS PAGE Tag

Product Specification


Species Mouse
Synonyms Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4), Cd152
Accession P09793
Amino Acid Sequence

Protein sequence (P09793, Glu36-Asp161, with C-10*His) EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 15.6 kDa Observed MW: 20-30 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CTLA-4 or CTLA4 (cytotoxic T-lymphocyte-associated protein 4), also known as CD152 (cluster of differentiation 152), is a protein receptor that functions as an immune checkpoint and downregulates immune responses. CTLA-4 is constitutively expressed in regulatory T cells but only upregulated in conventional T cells after activation – a phenomenon which is particularly notable in cancers. It acts as an "off" switch when bound to CD80 or CD86 on the surface of antigen-presenting cells. The CTLA-4 protein is encoded by the Ctla-4 gene in mice and the CTLA-4 gene in humans.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 95554049660

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
✨Isa✨
Port Orchard, US
★★★★★ 5
Cozy and stylish. Very impressed with the quality.
Color: Beige, Size: Queen
I love it! It’s so soft, cozy, and warm. Perfect as a throw blanket and for sleeping. The material is very durable. The stitching looks well done. Overall, it’s a great blanket worth your money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
A
Verified Purchase
Amazon Customer
Draper, US
★★★★★ 5
Highly recommend this extra soft, plushy, ripple warm fluff blanket! Looks great, feels great!
Color: Light Blue, Size: Twin
Oh wow this is such a nice blanket!! I have 3 of their regular fleece blankets, without the ripple- just plain fleece and they get washed 1x a week for about 2 years now and they have held up beautifully —- except for the mocha one I keep on my bed that my dog loves to dig in is starting to get frayed —- but it is still nicely soft! Just looks a bit worn so popped on for a bed upgrade since we are in winterageddon the saga that never ends this winter 2026…. I was going to order the same mocha again because I really like this brand and I absolutely get the 25$ moneys worth at 2 years… then this rippled one showed up…. Ok let’s try something new. I am SO glad I upgraded to this ripple! It is plush, and soft, and washed beautifully, and dried beautifully in reg cotton heat— even though it says medium heat care…. I put it on my bed and it looks beautiful! The ripples feel so soft and fluffy— but no fluff or fabric cast off! Even going through the dryer I thought for sure I would have a lint tray full—- it really wasn’t a lot! The color of the light baby blue is just perfect for a cream bedroom or as a navy accent color— it’s a cool true baby blue that looks great with my navy beige and cream bedroom. It is so warm! Much thicker feeling than the plain fleece blanket by bed sure—- some will like the heavier weight- I personally like the weight of blankets so this was a win!! 100% worth the price- highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
M
Verified Purchase
M. Dawson
Chelsea, US
★★★★★ 5
Great Blankets!
Color: Light Purple, Size: Twin XL
So soft and cozy! Great colors. Have bought a couple of these blankets now and love them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
A
Verified Purchase
Amazon Customer
Draper, US
★★★★★ 5
Cozy blanket
Color: Light Brown, Size: Twin XL
Oh my gosh...this blanket is so soft and warm...I debated between the light brown and white and choose the light brown because it matched my decor in the bedroom....it is light weight but very cozy and warm....I love it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
A
Verified Purchase
Amazon Customer
Omaha, US
★★★★★ 4
Very Soft Blanket NOT Only For Women and Girls Go For it Guys - BUY THE BLANKET
Color: Orange, Size: Queen, Color: Orange, Size: Queen
This bed, sure, gentle, soft queen, blanket for bed, cozy, soft, fall, blankets, for women, cute large fall throws for girls, orange, 90 X 90 inches is sold by: BEDSURE a seller that is located in CHINA The product is made in CHINA The product arrived in a box with a label, stuck on it not like packaging. You would see if you were buying a blanket at a retail store. Upon removing it from its airtight inner sealed bag, it had a very strong chemical odor to it, and it was very smashed. I placed it in the dryer on high heat for 10 minutes and it really did help to remove the odor and fluff the blanket up. I'm a little confused why this blanket is only for a woman and girls? At least that's what I had for when I read the title of the listing so I guess if you are a man, you cannot have this blanket kind of odd and if I were the seller, I would change that because it definitely will affect search results... I used the blanket on top of my bed as an actual comforter. My bed is a full-size bed. I ordered a queen size blanket, and it covers it nicely. It is probably one of the softest blankets I have ever felt in my life and yes, I would recommend this if you were in the purchase for a nice large, soft, cozy blanket!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026

recommand products