SKU: 1326136170

Human IL-19, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-19, His tagProduct Specification Species Human Synonyms Melanoma differentiation associated protein like protein, NG. 1, ZMDA1 Accession Q9UHD0 Amino Acid Sequence Protein sequence(Q9UHD0, Leu25 Ala177, with C 10*His) LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSAGGGGSHHHHHHHHHH Expression System CHO Molecular Weight Theoretical: 19. 4kDa Actual: 28 32kDa

Product Specification


Species Human
Synonyms Melanoma differentiation-associated protein-like protein, NG.1, ZMDA1
Accession Q9UHD0
Amino Acid Sequence

Protein sequence(Q9UHD0, Leu25-Ala177, with C-10*His)
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMFSAGGGGSHHHHHHHHHH

Expression System CHO
Molecular Weight Theoretical:19.4kDa Actual:28-32kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin 19 (IL-19) is an immunosuppressive protein that belongs to the IL-10 cytokine subfamily.The IL-19 protein is composed of 159 amino acids and has a quaternary structure with alpha helix motifs and loops. IL-19 is preferentially expressed in monocytes, macrophages, and T and B lymphocytes, but interacts with immune cells (macrophages, T cells, B cells) and non-immune cells (endothelial cells and brain resident glial cells, etc). IL-19 is associated with broad functions across inflammation, cell development, viral responses, and lipid metabolism. As an immunosuppressive cytokine, IL-19 promotes the Th2 (regulatory) T-cell response which supports an anti-inflammatory lymphocyte phenotype, dampens the Th1 T-cell response and inflammatory cytokine secretion (IFNγ), increases IL-10 (anti-inflammatory) expression in peripheral blood mononuclear cells (PBMC), and inhibits the production of immunoglobulin G (IgG) from B cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1326136170

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Renaissance Man
Phoenix, US
★★★★★ 5
Must-have book for all poets!
Format: Kindle
Every poet and playwright must own this book. It is a great resource for MFA writing students as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 23, 2018
D
Verified Purchase
dhrambo
Lake Worth, US
★★★★★ 1
Kindle Version is HORRIBLE
Format: Kindle
I recently bought the Kindle Version, and although I love this book as a reference guide the publisher did not include indexing which does not allow a reader to search making it almost impossible and very time consuming to hunt down a term or entry. If you are considering buying the kindle version I would highly recommend purchasing the paperback version as it will be much easier to peruse the entries.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 11, 2012
B
Verified Purchase
Bob Wofford
Carnegie, US
★★★★★ 5
Book received in good order.
Format: Paperback
Satisfied with product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2021
R
Verified Purchase
Ron Lee
New York, US
★★★★★ 5
Wow, Wow Wow, wonderful book! You won't be able to put down.
Format: Paperback
Enemies to lovers Collin and Olivia are the perfect pair in an opposite attracts that really hits on all cylinders! After a fire Olivia tries to get her feet back on the ground and moves in with her brother and Collin. Collin just seems to have everything together and Olivia, well not so much. But the more they banter the more the heat is turned up and they stumble into something they are both not sure of. Plenty of mis understandings on both sides and the plot device of mis texting is taken to a high degree, but oh when all is straightened out the HEA is the best. As author Painter knew we needed more, the bonus scenes are oh so satisfying. Great, great book!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
I
Verified Purchase
Imstilljennyfromtheblock24
Lowell, US
★★★★★ 4
Fun light RomCom
Format: Paperback
Rating: ⭐️⭐️⭐️⭐️ 4/5 Spice rating: 🌶 1.5/5🥵 Read if you like the following tropes: • Enemies to Lovers           • Brother's best friend          • RomCom                  • Forced proximity.    "So tell me exactly what you're wearing" It has been WAY too long since I've read a RomCom and this was THE perfect book to remind me how much I missed them! I read this book in one day simply because I could not put it down or stop thinking about it. "Mr. Wrong number: I texted the wrong number, didn't I? Me: Yeah, you did :)" This was such a light, fun, quick read that had me laughing. "I'd gone from finding her the most annoying girl in the planet to being inexplicably obsessed with her. " Loved the duel POV and how because the two MC's know each other, you not only got 🔥 banter between Colin and Olivia but also between Mr. Wrong number and Misdial (2x the 🔥 banter??? SIGN ME UP🙋‍♀️) "She was the first thing I thought of when I woke up in the morning,  and the last thing before I feel asleep. I would blow off anything to be with her, because everything was brighter when Olivia was around. " I Loved Olivia's disastrous luck, her passion for writing and live in the moment spirit. And I Loved the whole plot and texting element to the story . The one character I couldn't stand was Olivia's mother🙄😡 ugh. IYKYK I look forward to reading more from Lynn Painter as I really enjoyed her writing style.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2023

recommand products