SKU: 1529982199

TMIGD2/CD28H Fc Chimera Protein, Human

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TMIGD2/CD28H Fc Chimera Protein, HumanProduct Specification Species Human Accession Q96BF3 Amino Acid Sequence Leu23 Gly150, with C terminal Human IgG1 Fc

Product Specification


Species Human
Accession Q96BF3
Amino Acid Sequence

Leu23-Gly150, with C-terminal Human IgG1 Fc LSVQQGPNLLQVRQGSQATLVCQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIASFPGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 49-64kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Transmembrane and immunoglobulin domain containing 2 (TMIGD2)is new a immune checkpoint molecule of the B7:CD28 family which is a novel cell adhesion receptor that is expressed in various human organs and tissues, mainly in cells with epithelium and endothelium origins. TMIGD2 regulates cellular morphology, homophilic cell aggregation, and cell-cell interaction. TMIGD2 activity also modulates actin stress fiber formation and focal adhesion and reduces cell migration. Silencing of expression of TMIGD2 by small interfering RNA (siRNA) and by ectopic overexpression in endothelial cells showed that TMIGD2 regulates capillary tube formation in vitro, and B16F melanoma cells engineered to express TMIGD2 displayed extensive angiogenesis in the mouse Matrigel angiogenesis model. Moreover, TMIGD2, through its proline-rich cytoplasmic domain, associates with multiple Src homology 3 (SH3)-containing signaling proteins, including SH3 protein interacting with Nck (SPIN90/WISH), bullous pemphigoid antigen-1, and calcium channel β2.Silencing of expression of SPIN90/WISH by siRNA in endothelial cells showed that SPIN90/WISH is required for capillary tube formation. These features of TMIGD2 suggest that TMIGD2 is a novel receptor that plays an important role in cell-cell interaction, cell migration, and angiogenesis. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1529982199

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Placeholder
Waukegan, US
★★★★★ 2
Side sleeper- lost loft within 2 weeks
Size: Standard/Queen (Pack of 1), Style: High Loft (6"-7")
Side sleeper and within 2 weeks this pillow has lost its loft and has become lumpy. I have spent so much money trying to support my neck and shoulders, this unfortunately is not it. I will continue my search and return this one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026
A
Verified Purchase
Ashley
Alexandria, US
★★★★★ 4
Mixed Feelings on the Saatva Pillow - A Comprehensive Review
Size: King (Pack of 1), Style: High Loft (6"-7")
Updated Edit (June 2024) : In my quest to find the perfect pillow, I initially purchased the high loft version of this pillow, but it turned out to be a bit too high for my liking. I then decided to try the standard size, and I like it much better! The pillow can still get lumpy and requires fluffing, but opting for the standard lower loft has definitely improved my experience with it. While I still use this pillow occasionally, I generally stick with my Purple Harmony pillow more. Changing my rating to 4 stars. --- Background: Over the past 2 years, I have embarked on a journey to find the perfect pillow, testing over ten different options, including numerous high-end brands. My latest trial was the Saatva pillow, renowned for its rave reviews. Expectations vs. Reality: Despite its widespread acclaim, my experience with the Saatva pillow did not meet my expectations. I opted for the higher loft variant, aligning with my general preference, yet I found it too high of a lot even as a primary side sleeper. Material and Comfort: The Saatva pillow, composed of both latex and down alternative, presented a lumpy texture. This inconsistency resulted in varied support depending on the position of my head. Unlike my regular down alternative pillow, the Saatva required frequent re-fluffing and adjusting throughout the night. Comparison and Value: Considering its price and the overwhelming number of positive reviews, my disappointment was notable. Surprisingly, a more affordable down alternative pillow from Amazon outperformed the Saatva in terms of support and comfort, despite the latter's use of higher quality fabrics and its significantly higher cost. Final Verdict: This pillow was one of the last in my quest to discover the "best" pillow. Sadly, it ranks in the lower ranks among the high-end, expensive pillows I've tried. I preferred the Purple Harmony pillow over the Saatva, albeit with reservations about the Purple Harmony as well. Conclusion: The Saatva pillow, while undoubtedly high-quality and possessing comfortable aspects, did not live up to my expectations, landing it in my pile of unused pillows. It may suit others, but for me, I only give it a 3 out of 5 stars rating.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2023
M
Verified Purchase
Megan
Boise, US
★★★★★ 5
Wonderful!
Size: Standard/Queen (Pack of 1), Style: High Loft (6"-7")
I ordered the loftier version of the pillow and I love it! I'm a side sleeper and I've been having pillow issues over the last few years where I swear every pillow is either too tall, too thin, too soft to provide support, to firm and hurts my ears, or the stuffing is too slick or something and migrates away from wherever I put my head. It's been... A time. But this pillow has been wonderful! I've been using it for a couple weeks now and it's the perfect height for me! The latex inner chamber provides some much needed support, but the softer outer chamber gives me enough cushion to keep my ears from aching. I will say that, while this is the perfect height for me, personally, I think that if you're someone who prefers a pretty lofty pillow, that this might not be tall enough for you. I ordered the taller version, and it feels right for me, but I've noticed in my pillow buying extravaganza that even pillows that everyone else loves that are designed for side sleepers are usually just too tall for me. So if this pillow is right for me, and you prefer a pretty lofty pillow, I really bet that this won't be tall enough in that case. It's definitely more of a medium loft, rather than a very high loft
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 20, 2024
E
Verified Purchase
Erin Allen
Battle Creek, US
★★★★★ 5
Read this review. This pillow saved me.
Size: Standard/Queen (Pack of 1), Style: High Loft (6"-7")
I have to testify about this pillow, my brothers and sisters. Ever since I hit my 30s, my body has gone down. Aches and pains. Pops. Crackles. Snaps. It’s ridiculous. Over the last 2 years, I have managed to injure a muscle in my shoulder and the pain is unbearable when it is inflamed. I finally narrowed it down to the pillow I was sleeping on. I have an attachment to a pillow I’ve owned for over 20 years - that’s another story. I could fold it 3 times and it was finally thick enough to support my head. My shoulder got so tore up recently that I had to go through 2 rounds of steroids plus round the clock ibuprofen. Waking up in the night, the whole ordeal. I ordered this pillow after much research all over the internet. I was appalled by the $165 price ticket. But when you’re in that level of pain, you’re just about willing to do whatever it takes. The first night I immediately noticed I got more consecutive hours of sleep than I had in weeks. A week later and my shoulder is pain free. I could’ve cried. The height of this pillow stabilizes my neck and shoulders perfectly. It is firm, but gives and contours to your neck and head. It’s a heavy pillow but I don’t even care. Truly I don’t think I’ll ever go back. This pillow has saved my shoulder and I’ll never stop thanking God for it. If you’re experiencing back, shoulder, or neck pain and are considering this pillow, just order it. Please. Just do it. I’m forever changed. But I’m still keeping 20 year old pillow… just for sentimental purposes. 😂
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2025
A
Verified Purchase
Andrew Janes
Draper, US
★★★★★ 5
Amazing. The Perfect Pillow for Side Sleepers with neck pain!
Size: Queen (High Loft), Number of Items: 1
I do have to update my experience. This still is a very comfortable pillow, it's just I can't sleep with it under my head (it's now my hug pillow). After using for 2 weeks, I developed severe neck spasms. Pillows are very individulized and as it turns out, I probably need a firmer pillow than this "highly" comfortable pillow can offer. Will NOT change my rating. Wow! I'm impressed with this pillow so far. I'm a side sleeper mostly but chose the medium-high loft 6.2" as recommended which was the perfect height. I didn't see any taller options but this has turned out just right. I did hours of research before chosing this product, which turned out to be advantageous. It's not as cooling as my old memory foam pillow with the gel layer but it stays cool long enough that I don't have to move the pillow around to be comfortable before falling asleep. It's surprising lightweight. I like it much more than any memory foam I've ever had. The best news was that within a few days my headaches and neck pain have improved by 80%. I am really very impressed with the quality of this pillow. It is softer than I anticipated but still firm enough to keep my head elevated giving me perfect spine alignment and great support. It truly is the MOST COMFORTABLE supportive Pillow I have ever slept on! The smell is only minor at It's worst and has nearly disappeared after just 4 days. It is a mild latex smell but definitely NOT petroleum. It's in the moderate price range at ~$100 and worth every cent. High value for the price. I really really like this pillow and highly recommend it. Big fan! Might irder a 2nd as a backup if it doesn't last but it's so well made I feel that won't be a problem.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 22, 2026

recommand products