SKU: 17840278438

FABP1 His Tag, Human

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP1 His Tag, HumanProduct Specification Species Human Synonyms LFABP Accession P07148 Amino Acid Sequence Met1 Ile127, with N terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAG E& RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder

Product Specification


Species Human
Synonyms LFABP
Accession P07148
Amino Acid Sequence Met1-Ile127, with N-terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Expression System E.coli
Molecular Weight 16kDa (Reducing)
Purity >95% by SDS-PAG E& RP-HPLC
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

FABP1 (LFABP) has been initially characterised in the liver (thus its name) but is also expressed in small intestine (duodenum and jejunum). FABP1 appears to be the most promiscuous FABP as it was reported to bind a variety of small molecules in addition to fatty acids including bile acids, lysophosphatidic acid, prostaglandins, fatty acyl-CoA, bilirubin and heme. FABP1 is a PPARα target gene. While some studies suggested that FABP1 might be involved in the delivery of ligands for PPARα activation in the nucleus, FABP1-deficient mice showed normal regulation of PPARα target genes regulation. FABP1 was reported to enhance apoB-lipoprotein secretion, which would suggest involvement of this protein in the delivery of fatty acids to the ER for esterification into lipoprotein-destined TG. Hepatic fatty acid oxidation is also diminished in fasted FABP1 knockout mice, which implies deficient transport of fatty acids to the oxidative pathway. Interestingly, no accumulation of intracellular TG accompanied attenuation of fatty acid oxidation even when the mice were challenged with a high-fat diet.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 17840278438

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lori Cureton
Port Orchard, US
★★★★★ 4
Cute but very inexpensive
Keep in mind you get what you pay for. That said, this is a very cute watch and my granddaughter loves it. It was a Christmas gift and when she first opened it and set it, it would not run. Later, when I was working on requesting an exchange, I noticed it was running. Hopefully it will continue to run and she will be happy with this watch. It's a unique style and perfect for a teenage girl.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
K
Verified Purchase
kat
Boise, US
★★★★★ 5
perfect fit!!
This watch is reliable & breaks in nicely for a comfortable fit
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2024
S
Verified Purchase
Suzanne Raif
Bozeman, US
★★★★★ 1
Pretty but leather is mildewed.
I read the reviews but took a chance that the one I received would not smell mildewed. Oh my!! It stinks to high heaven!!! And it is too small for my wrist…another chance I took. Instead of returning it, I’m going to try and replicate it using the watch and dangles with ribbon and cords. It was wrapped very tightly in bubble wrap. Perhaps the leather would not have mildewed if it had been able to breathe. Boy! Does it stink!!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 29, 2025
O
Verified Purchase
Oceanmotion
Massapequa, US
★★★★★ 3
Snap closure watch.
Not the best quality or materials but remember, it’s extremely inexpensive.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 8, 2025
T
The Bowtie Artist
Waukegan, US
★★★★★ 5
Nice accessory for anyone to wear, goes well with any style
Durable material makes it easy to slip onto any wrist (plus, adjustable strap, so there's that too). The fact that the watch actually WORKS is an added point, considering most of these out there have the clock as a graphical enhancement rather than an actual working point to the piece. The title of the item says for girls, but whoever you are out there, wear it despite what it says. These sorts of accessories are multi-person usage. It looks cool with any outfit design, too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2023

recommand products