SKU: 18453825577

Human NUT, His tag

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NUT, His tagProduct Specification Species Human Synonyms Nuclear protein in testis, C15orf55, NUT Accession Q86Y26 Amino Acid Sequence Protein sequence (Q86Y26, Thr920 Ala997, with C 10*His) TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSAGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 10. 1 kDa Observed MW: 25 30 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms Nuclear protein in testis, C15orf55, NUT
Accession Q86Y26
Amino Acid Sequence

Protein sequence (Q86Y26, Thr920-Ala997, with C-10*His) TCPLNVHSYDPQGEGRVDPDLSKPKNLAPLQESQESYTTGTPKATSSHQGLGSTLPRRGTRNAIVPRETSVSKTHRSAGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 10.1 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

The nuclear protein in testis gene encodes a 1,132-amino acid protein termed NUT that is expressed almost exclusively in the testes, ovaries, and ciliary ganglion. NUT protein facilitates the acetylation of chromatin by histone acetyltransferase EP300 in testicular spermatids. BRD4 is the bromodomain-containing protein 4 gene. BRD4 protein involved in the development of neoplasms. The product of the BRD4-NUTM1 fusion gene, BRD4-NUT protein, stimulates the expression of at least 4 oncogenes, MYC, TP63, SOX2, and MYB in cultured cells. It is generally accepted that the BRD4-NUT protein promotes these neoplasms by maintaining their neoplastic cells in a perpetually undifferentiated, proliferative state. NUT carcinoma is a rare, highly aggressive malignancy. Studies have found that 66%-80% of NUT carcinomas harbor a BRD4-NUTM1 fusion gene while the remaining NUT carcinomas involve the BRD3-NUTM1, NSD3-NUTM1, ZNF532-NUTM1, or ZNF592-NUTM1 fusion gene.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 18453825577

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jennifer M Floyd
Lowell, US
★★★★★ 5
Wonderful!
Format: Imitation Leather
Beautiful - puts the wordless groans within my spirit into words!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
M
Verified Purchase
mom24growinkids
West Palm Beach, US
★★★★★ 5
Daily tasks in a wonderfully sacred light!
Format: Imitation Leather
Wow! This is a wonderful way to remember that every moment is holy and should be honored. Well written! The illustrations are so good. I only wish there were twenty volumes instead of just 3!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2025
D
Verified Purchase
David Dwayne Thomas
Grantham, US
★★★★★ 5
An aid to the Bible to walk out Gods will for your life.
Format: Imitation Leather
What a great book and addition to the volume series. When I first received my first volume some 2 years ago from my daughter and her pastor husband I thought it would just be another good self help book. Little did I know how God would use this series in every aspect, action and event of my life and how every moment and thought is a given chance by God to honor, worship and bring praise to the glory of His grace. Other than the Bible, I recommend above all other books to make it the guide and manual of how you walk out the Christian life in light of “Every Moment being Holy.”
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2026
K
Verified Purchase
Karis Brister.
Battle Creek, US
★★★★★ 5
Must have resource for Christians.
Getting the kindle version of this book was such a good choice! It’s nice to have it on my phone so that I can take screenshots and share prayers with friends. This collection is so wonderful and I’m really thankful that the rabbit room continues to produce more volumes.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2025
C
Verified Purchase
crick
Boise, US
★★★★★ 5
Great to give as gifts
Format: Imitation Leather
While I have enjoyed this book myself I think it's most valuable as a gift. I keep several on hand and give them out to friends when we meet up and it goes over really well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 2, 2025

recommand products