SKU: 20351439222

Human CD63, His tag

Sale price$173.25 Regular price$192.50
Save 10%

Pay in installments of $48.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD63, His tagProduct Specification Species Human Synonyms Granulophysin, Lysosomal associated membrane protein 3 (LAMP 3), Lysosome integral membrane protein 1 (Limp1), Melanoma associated antigen ME491, OMA81H Accession P08962 Amino Acid Sequence Protein sequence(P08962, Ala103 Val203, with C 10*His) AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight

Product Specification


Species Human
Synonyms Granulophysin, Lysosomal-associated membrane protein 3 (LAMP-3), Lysosome integral membrane protein 1 (Limp1), Melanoma-associated antigen ME491, OMA81H
Accession P08962
Amino Acid Sequence

Protein sequence(P08962, Ala103-Val203, with C-10*His)
AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 13.2kDa Actual:17-30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

CD63 is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak Syndrome. Also this protein has been associated with tumor progression. CD63 is a good marker for flow cytometric quantification of in vitro activated basophils for diagnosis of IgE-mediated allergy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 20351439222

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
JLJ
Belleville, US
★★★★★ 5
Shockingly Great: Do Not Be Skeptical Of The Ultra Low Price
Style: Stereo Receiver, Configuration: Receiver
Do not allow the extremely low price on this Sony STRDH 190 stereo receiver to in any way prejudice you against considering it as a wonderful entry-level stereo receiver. I have purchased thousands of products on Amazon over the past 25 years, and I cannot think of any item that pleasantly surprised me more profoundly than this one. I also purchased the matching (style) Sony turntable PS-LX310BT which works perfectly with the STRDH 190 receiver. Sony's lowest priced receiver now sells for the astounding bargain price of only around $200, though I caught it on sale for closer to $150... and as impossible as this is the believe, it has in recent years gone on sale for as little as $99(!) I have no idea how Sony makes a profit at these price levels. Now I know, most people would think, "there is just no way a $200 receiver is high quality"... but I am telling you, that is dead wrong in this case, and you should prepare to be blown away by what you get at this crazy low price point. This is NOT a no frills unit. It is feature packed. It has connections for TWO PAIR (four total) speakers, and PLENTY of clean no-distortion power to drive all four speakers to loud and clear volume levels. It also has an A/B speaker switch to play through speaker set A, or speaker set B, or all four speakers at once. It has a phono stage pre-amp which is actually very good. Seriously, it is much better than the phono stage pre-amp built into my Emotiva integrated amp for which I paid $1,000. It plays vinyl loud with no distortion. You will NOT need an external phono pre-amp. It has excellent Bluetooth wireless connectivity built in... no trouble getting it to instantly recognized sources and play them perfectly. You can play all the music on your iPhone or other digital device, wirelessly. It has a huge allotment of extra connections, ... a whopping FOUR inputs... so you can also hook up a CD player, and another external device of your choice, and another one after that, and another one after that! (WOW). And that's is not counting your PHONO input which is actually a fifth input connection. Astounding accommodation of external sources at this (or almost any) price point. If you are a dinosaur who listens to FM ... it's got an FM receiver with 30 station presets, and an output to hook up a proper external FM antenna, and a long-wire FM antenna is included in the package Sony says the "HiRes" audio produced by this unit is "superior to CD quality"... though I am not sure how to measure that claim, especially if the extrnal source you are using is a CD player. It comes with a very high quality remote control, with real buttons, and many features. You can actually program each of your external sources to appear in the illuminated display as the specific names you want, rather than a generic default source name like "CD". The low price may raise an eyebrow, and the fairly light weight (much heavier on one side than on the other curiously) nature of the unit may also cause doubt... but only until you set it up and start listening, and your jaw drops. I would put this sub-$200 receiver up against any receiver on the market priced under $800, (and probably several of them priced at twice that much!) and I believe you will not be disappointed in the sound quality of Sony's entry-level unit. You certainly will NEVER find another receiver anywhere near this price point with so many features and inputs... all of which work flawlessly. This is the greatest bargain in the world of affordably-priced HiFi equipment. It is easily worth multiple times the asking price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2025
I
Verified Purchase
Ink Independent
Dallas, US
★★★★★ 5
Overall Excellent - Thorough Review - READ ME
Style: Stereo Receiver, Configuration: Receiver
I'm not an audiophile per se, but I do have elevated listening preferences. I enjoy finding the value in devices, and system configs. So that's the reason I tried this more budget-friendly receiver. Aesthetics: The look is very sleek and modern, which is great but sometimes I miss the nostalgia of more knobs. There is no base/treble knob and most everything is controlled by remote. That's fine I suppose, just be aware. The volume knob is very large and traditional which I love, but is also very stiff and not buttery smooth like you might expect. Perhaps that will break-in. Sound Quality: Wow, this sounds incredible. There is definitely a DSP happening that is noticeably awesome. It's referred to by Sony as Pure Direct. If you want to by-pass this, you can, but you'll hear right away the difference is major. I'm using simple Klipsch bookshelf speakers, and my expectations are surpassed on how much they come to life with bright and rich sound. Definitely a nice pairing for those shopping for speakers along with this unit. Overall the SQ is gonna be tough to beat without spending exponentially more. Remote: The remote is nice, sleek, and has what you need to quickly access. No complaints there. Installation: Takes minutes, super easy. Didn't follow any instructions due to my general confidence hooking up home audio gear. Overall: I highly recommend this one, and I'm picky. Initially, I fully expected to return this receiver, but plan to keep it. The only thing that may change my mind, is if I miss the nostalgia... then I'll have to go vintage. But no way a vintage receiver will sound this good. Props to Sony. Well done :) A+
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2024
P
Verified Purchase
pete
Battle Creek, US
★★★★★ 5
Nice amplifier for the cost.
Style: Stereo Receiver, Configuration: Receiver
I had been using my Marantz model 22 receiver now for a couple years now with the TV, dvd player, and youtube music from my tablet. I like lots of knots and switches on my audio gear, I'm an engineer. I was getting tired of the seemingly endless up and down to adjust volume and whatever. And my inputs on the Marantz were maxed out. I searched Amazon to see what was available as a possible replacement that had a REMOTE. This Sony caught my eye. Relatively inexpensive, plenty of inputs, and specs I could trust, not a 3x4x5 box offering 220+220 watts of unlimited power! Ordered it and been using it for over a month now. Only 2 knobs, how good could that be? Well, it's remote let's me control everything without getting up. Plenty of output power, 100+100 watts of true RMS power. I didn't plan on using the Bluetooth but I tried it with the tablet, keeping the tablet by me, and it really impressed this old audiophile. I really don't have any negatives about it, even the fm sounds great. It was heavier than expected but not as much as that old Marantz. I even popped the cover. The build quality was what I consider good. I only wish I could find a service manual with the schematic for it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 23, 2025
J
Verified Purchase
James
Carnegie, US
★★★★★ 5
Great Banana Plugs
Size: 6 Pairs / 12 pcs
I recently purchased these FosPower banana plugs to tidy up my speaker wiring, and they’ve been a significant improvement over bare wire ends. Installation is straightforward: strip the wire, loosen the two tiny set screws, slide the wire in, tighten everything down, and then screw the barrel back on. Once assembled, the connection feels secure and tight, making it much easier to swap gear around and reducing the risk of stray strands causing a short. The standout feature of this design is the dual set-screw clamp. It firmly grips the speaker wire without relying on the outer collar to “crush” it in place. I’m using 12-gauge wire, and it holds well for my setup. Initially, the plugs may fit snugly in some binding posts. Once seated, there’s no wobble, but it might take a bit of extra push the first time. The set screws are small, so a bit of precision is needed. Use a small flathead screwdriver and don’t over-tighten them. Overall, these plugs feel well-made, look clean once installed, and fulfill their purpose as banana plugs: making speaker connections quick, neat, and reliable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
T
Verified Purchase
Todd C Blake
Fort Morgan, US
★★★★★ 5
Great Banana Plugs!
Size: 6 Pairs / 12 pcs
These FosPower banana plugs work very well. I have used dozens of these great FosPower banana plugs over the years, and they definitely work as advertised. When comparing apples to apples (or bananas in this case....lol), all Banana plugs work virtually the same way, and these banana plugs are no different. Strip speaker wire, unscrew banana plug cover, loosen speaker wire retaining screw(s), insert speaker wire, tighten speaker wire retaining screw(s), screw on banana plug cover, and wallah, a secure/conductive speaker/amplifier wire connector is created. Albeit, some banana plugs require the speaker wire to be splayed over a hollow post, and then they are held down by a screw-on retainer/cover. However, I much prefer these FosPower dual retaining screw type of banana plugs for their speaker wire holding ability. I always use high quality 14 gauge OFC speaker wire with these FosPower banana plugs, and they work perfectly together. I have used these FosPower banana plugs with many different speaker and amplifier brands over the years, including Klipsch, Pioneer, Polk, Denon, Dayton Audio, and Fosi with no problems at all. They just work, and work well. I have never had a FosPower banana plug break, release the speaker wire or short out, in all of the years that I have used them. Yes, these FosPower banana plugs do fit rather tightly into the connectors, at first, on a lot of speaker and amplifier brands/models. However, after the initial "squeeze" the banana plugs will lossen up, and become easier to install and remove. However, they still retain their great holding ability even after the initial squeeze. In order to overcome this initial "tightness," I usually just stick the FosPower banana plugs into a connector of an old portable amplifier, before assembling them, in order to squeeze them before inserting them into their final speaker or amplifier destinations. This is especially useful when working in tight places, where there is not much room to work in order to push the FosPower banana plugs into their tight connections firmly. Overall, I highly recommend these FosPower banana plugs. I am currently using them all over the house and shop for home theater and music listening (and testing projects). Just be aware of the tight fit in some speakers and amplifiers. Also, the 2 very tiny speaker wire retaining screws can be a challenge sometimes. Just use a good standard blade jewelers screwdriver, and be careful not to remove the retaining screws all of the way or over-tighten them. Once these things are mastered, using these FosPower banana plugs becomes second nature. Have fun!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 28, 2024

recommand products