SKU: 72453167348

Human IFN-alpha1, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IFN-alpha1, His tagProduct Specification Species Human Synonyms IFN alpha 1 13; Interferon alpha D (LeIF D) Accession P01562 Amino Acid Sequence Protein sequence(P01562, Cys24 Glu189, with C 10*His) CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKEGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 21kDa Actual: 20kDa Purity 95% by SDS

Product Specification


Species Human
Synonyms IFN-alpha-1/13; Interferon alpha-D (LeIF D)
Accession P01562
Amino Acid Sequence

Protein sequence(P01562, Cys24-Glu189, with C-10*His)
CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKEGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 21kDa Actual: 20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

INF-α1 is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 72453167348

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Michigan Cur
Birmingham, US
★★★★★ 5
A nice customizable organizer.
Color: Black, Color: Black
This is a nice organizer for a drawer or nightstand. Comes in a box that is not overly bulky and is well protected. It's quick and easy to adjust and put together. the seperators are magnetic so you can customize it to fit your needs. There are two cut outs for charging cords and it fits a phone easily along with other accessories. The unit feels solid and well built, it has a good weight to it. I do wish the deviders were a bit easier to get square, but that's more just my idiosyncrasies.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2026
J
Jason B
Whiting, US
★★★★★ 5
Nice Desk Organizer
Color: Black, Color: Black
This particular desk organizer has the little strips of wood that each have a magnet installed inside them. This allows you to move the wood strips to different locations and adjust the areas to fit whatever size item you want to put in there. It's very easy to just move them around and the bottom of the tray has a nice material in it that prevents scratching the items you place in there. The usable area on the tray is 12-1/2" x 8-1/4" x 3/4" and the overall size is 13-5/8" x 8-3/8" x 1". It fits nicely in drawers or simply having it sit on top of a desk to hold items. It also is made out of good quality and is very sturdy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 2, 2026
Q
Queen_bee
West Palm Beach, US
★★★★★ 4
Great product quality
Color: Black
This had literally everything I was looking for, but… just too large for the area I wanted it in. Check the measurements and compare that to your actual space. If they had about 1/2 to 1/3 of this size I would snatch it up in a heartbeat. It has a groove for your phone charging cable and the moving magnetic dividers are genius. I’m looking for something to put on my nightstand to allow the phone to charge at night but face down. Extra section for earrings or hair accessories, etc would be great. This has that potential. Just needed it smaller.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026
S
Sue S.
Birmingham, US
★★★★★ 5
Versatile organizer for men or women
Color: Black, Color: Black
This is a just drawer organizer tray or nightstand organizer that is very handsome with wood grain and metal the two bars are magnetic and you can move them around to suit the size of the items that you're placing in the organizer. I think it's a very versatile item that can use by either men or women and it's a decent size and it can fit small pieces of jewelry your phone a few other items if you were organizing your nightstand before bed certainly can go into a desk drawer or a nightstand drawer to suit your lifestyle. I think it was a good value for the money because it is yet another item that can help us be more organized in this busy world.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026
O
Outcast
Bozeman, US
★★★★★ 5
Simple, hefty configurable small tray
Color: Black, Color: Black
"Hefty" is not an expected description for a drawer organizer. But it is in this case because of the solid metal plate it's made from. You could brain a zombie with this tray and not dent it (the tray... the zombie's the one that would be dented). Guess the material choice does make sense since the two wooden dividers uses magnets to hold positions. A strong bump would be needed to shift the placed dividers. You get some basic configuration choices from the dividers. Including additional (different length) dividers would allow further sectioning options would have been nice. It also looks good too. Like the design and utility. Would also go for a bigger version. Perhaps that one, like this, would have secondary uses... perhaps as armor plating?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026

recommand products