SKU: 20770810889

FGF-21 Protein, Human

Sale price$122.40 Regular price$136.00
Save 10%

Pay in installments of $34.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FGF-21 Protein, HumanProduct Specification Species Human Synonyms Fibroblast growth factor 21 Accession Q9NSA1 Amino Acid Sequence His29 Ser209, with N terminal 6*His MHHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS Expression System E. coli Molecular Weight 25 kDa(Reducing) Purity 97% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms Fibroblast growth factor 21
Accession Q9NSA1
Amino Acid Sequence

His29-Ser209, with N-terminal 6*His MHHHHHHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Expression System E.coli
Molecular Weight

25 kDa(Reducing)

Purity

>97% by SDS-PAGE & RP-HPLC

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

20mM Tris, 100mM NaCl, pH7.5

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Fibroblast growth factor 21 (FGF-21) is a pleiotropic hormone considered as a major regulator of energy homeostasis. FGF-21 is mainly secreted by the liver, but it may also be expressed in skeletal muscle. In this sense, FGF-21 protein expression is induced by insulin in C2C12 myocytes, and FGF21 mRNA is upregulated by hyperinsulinemia in skeletal muscle in young healthy men. Moreover, it has been suggested that FGF-21 is a signal secreted by the skeletal muscle to communicate with adipose tissue under stress conditions. FGF21 has been shown to be a major regulator of hepatic lipid metabolism, with FGF-21 overexpressing mice being resistant to diet-induced obesity. Interestingly, recent studies suggest that FGF21 may exert anti-inflammatory actions in the pancreas, heart, and skeletal muscle. A reduction in the JNK and NF-κB signaling pathways has been proposed as the potential mechanism implicated in the FGF-21 anti-inflammatory effects.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 20770810889

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
carl mazaleski
Bozeman, US
★★★★★ 5
Fit
Size: 11.5 Wide, Color: Cognac
Comfortable and affordable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
T
Verified Purchase
The Product Connoisseur
Draper, US
★★★★★ 3
Classy pair that look great but don’t last
Size: 12, Color: Black, Size: 12, Color: Black
Great shoe. Slip on is easy and the shoes are comfortable and classy. Ten months later and the bottom has holes and didn’t last.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2025
J
Verified Purchase
Jon
San Leandro, US
★★★★★ 5
Love it
Size: 11, Color: Black
Almost the perfect travel shoe. Goes well with both casual and formal attire. Walked like a million steps with this in Japan, SEA, etc. only thing it probably can't do is probably hiking. Otherwise the leather feels really high quality, and the shoe slips on without much fuss. I'd describe the style as: a dressed-up Converse
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
J
Verified Purchase
jack brice
San Leandro, US
★★★★★ 1
Would not every buy marc Joseph shoes ever
Size: 11 Wide, Color: Black
The marc Joseph shoes did not hold up had a blow out rightside of shoes had the shoes for about two weeks when my wife noticed and say that not good.i buy Cohen shoes and Clarke shoes
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
J
Verified Purchase
Jon F
Natrona Heights, US
★★★★★ 2
Great shoe, horrible lace design.
Size: 13, Color: White, Size: 13, Color: White
This shoes look great and the materials for the actual shoe feel great. They run a little big that doesn't bother me. Unfortunately, the lace design is horrible. I've now have 2 pairs of these shoes and both times the bottom lace has ripped out of the stitching. The first time was on the 2nd day I wore them, and the replacement pair to those it happened after I walked 20 feet. Both times I've tied a knot in the bottom lace so that I could get through the day. Ideally these laces should be connected together and not attached to the shoe (this is how both of my Skechers Slip-ins are designed). Because I like the rest of the shoe so much I'm buying elastic laces to replace the horrible original laces.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2025

recommand products