SKU: 21676969522

Ephrin-A4 His Tag Protein, Human

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Ephrin-A4 His Tag Protein, HumanProduct Specification Species Human Accession P52798 Amino Acid Sequence Leu26 Gly171, with C terminal 8*His LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 24kDa (Reducing) Purity >95% by SDS PAGE&RP HPLC Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Human
Accession P52798
Amino Acid Sequence

Leu26-Gly171, with C-terminal 8*His

LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

20-24kDa (Reducing)

Purity

>95% by SDS-PAGE&RP-HPLC

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

EPH-related receptor tyrosine kinase ligand 4 (Ephrin-A4) also known as EFNA4, is a member of the Ephrin family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Eph/ephrin interactions are implicated in axon guidance, neural crest cell migration, establishment of segmental boundaries, and formation of angiogenic capillary plexi. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. An exception is the EphA4 receptor, which binds both subclasses of ephrins. Ephrin-A4/EFNA4 functions as a cell surface GPI-bound ligand for Eph receptor, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 21676969522

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
a_estrada
Chelsea, US
★★★★★ 4
Practical and Simple Read
Format: Perfect Paperback
I enjoy all of Gavin’s content. While it isn’t groundbreaking, this book is an easy read and great for anyone looking for practical and applicable ways to navigate tensions surrounding tough subjects in today’s social, political, and ecumenical climate. Gavin’s tone is kind and serves like a guide as you read. It can be read in a couple of sittings but still very insightful.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
T
Verified Purchase
TB
Cuba, US
★★★★★ 5
Incredibly Relevant and Balanced
Format: Perfect Paperback
Gavin is probably the person I’d look to first to learn how to handle disagreement and conflict in a loving, Christ-honoring way. This book doesn’t disappoint! It’s well written and concise. It only took me a couple of hours to get through it. If you’re a Bible-believing Christian, there’s probably nothing in this book that will surprise you, and that’s all the more reason to read it. I’ve found that the simplest truths that are so often taken for granted are the ones that have the greatest impact when we really take the time to consider them. This book should be required reading for anyone who wants to interact with others on the internet!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 24, 2025
T
Verified Purchase
T. Brockman
Houston, US
★★★★★ 5
Read it
Format: Perfect Paperback
Much needed in our world today. Read and reflect and apply to your own relationships. Warm and courageous counsel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
T
Verified Purchase
Tori09
Charlottesville, US
★★★★★ 5
Great advice!
Format: Perfect Paperback
This has been very helpful for navigating tough arguments especially with loved ones. Helps take the focus off yourself and see the opposite point of view.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
J
Verified Purchase
Josh
Battle Creek, US
★★★★★ 5
Succinct and Spot on
Format: Perfect Paperback
This is a fantastic little book and much needed. A youth discussion group met and we used this book as the basis for the topic of disagreeing to the glory of God. I heard multiple ways students had applied it in their contexts at home and school. Gavin should be glad to know it has made a difference.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2025

recommand products