SKU: 22310644345

Felis catus CD4, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Felis catus CD4, His tagProduct Specification Species Felis catus Synonyms T cell surface antigen T4 Leu 3 Accession P79355 Amino Acid Sequence Protein sequence (P79355, Met1 Thr413 (Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149), with C 10*His)

Product Specification


Species Felis catus
Synonyms T-cell surface antigen T4/Leu-3
Accession P79355
Amino Acid Sequence

Protein sequence (P79355, Met1-Thr413 (Lys20Glu, Ser84Cys, Val103Ile, Asn115Asp, Ser142Thr, Ser169Gly & insertions of SerThr between Thr148 and Ser149), with C-10*His) MNQGAVFRHLLLVLQLVMLEAAVPQGKEVVLGKAGGTAELPCQASQKKYMTFTWRLSSQVKILESQHSSLCLTGSSKLKTRFECKKILWDQGSFPLVIKSLQIADSGIYTCEVEDKKREVELLVFGLTAKVDPSGSGGSSSTSTSTSTSTSIYLLQGQSLTLTLESPSGSNPSVQWKGPGNKSKSGVHSLSLSQLELQESGTCTCTVSQSQKTLVFNTNILVLAFRKVSNTVYAKEGEQVEFSFPLNFEDENLMGNLRWKAEGAPSSLLWISFTLKNKQLSVKEVDPYSKLQMMDSLPLRFTLPNVLSRYAGSGNLTLVLDKGQLQQEVKLVVMRVTQSGNNLTCEVLGPTSPELTLSLKLKGQAAKVSKQQKMVRVEDAEAGTWQCLLSHKDKVLLASKAEVLPPVLTRTWTGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 46.8 kDa Observed MW: 50 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD4 (cluster of differentiation 4) is a glycoprotein that serves as a co-receptor for the T-cell receptor (TCR). CD4 is found on the surface of immune cells such as T helper cells, monocytes, macrophages, and dendritic cells. CD4+ T helper cells are white blood cells that are an essential part of the immune system. They are called helper cells because one of their main roles is to send signals to other types of immune cells, including CD8 killer cells, which then destroy the infectious particle. If CD4 cells become depleted, the body is left vulnerable to a wide range of infections that it would otherwise have been able to fight. CD4 continues to be expressed in most neoplasms derived from T helper cells. The antigen has also been associated with a number of autoimmune diseases such as type I diabetes mellitus.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 22310644345

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Book Junkie
Pawtucket, US
★★★★★ 5
Best dog ball in the world!
Size: Large, Pattern Name: Pack of 1, Size: Large, Pattern Name: Pack of 1
My dog is singularly obsessed with playing ball. He would drop a steak to chase a ball. (He'd return to the steak, but not without the retrieved ball. He's not an idiot.) He makes dangerous leaps, crashes into trees, and runs fast enough to catch thrown balls before they even hit the ground. Since he doesn't care about his own wellbeing, it's my job to protect him as much as I can. And a lot of balls are hard enough to cause him pain or dental damage when he mistimes a catch. Enter the ChuckIt Glow Ball! The minute Cowboy got his first Glow Ball, he no longer had any interest in the dozens of tennis balls scattered around the house and yard. If I took the Glow Ball away and instead threw a tennis ball, Cowboy would run to retrieve the ball, then return without it and begin looking all over the house for the Glow Ball. The Glow Ball is tough enough to survive Cowboy's big, sharp chompers, yet it's soft enough to do no harm when it hits him in the face. The glow feature is a huge bonus, too. Cowboy gets distracted by chipmunks and squirrels when we're playing, so he sometimes can't remember where he dropped the ball to pursue the interloper. If the ball was exposed to enough light before it was misplaced, it will be easy to find once the sun goes down. (Otherwise, Cowboy always finds it eventually.) When I'm feeling nocturnal, I'll put the ball under a light for a few minutes to activate the electrons, then treat my boy to a middle-of-the-night game of fetch. I was so happy to see these on sale, I bought a lifetime supply for my pantry. The size guide seems accurate. ChuckIt recommended the large size for a dog of Cowboy's weight and that size is perfect. Highly recommended product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 14, 2024
J
Verified Purchase
J. Rogers
Bozeman, US
★★★★★ 5
This is a great ball for high energy dogs.
Color: Blue
I have a Belgian Malinois, so you can imagine the Maligator jaws. Just opened this today and let her play with it indoors. She LOVES IT. It wore her out and it’s a toy she can really stay focused on without needing me to throw or roll for her. It moves on its own! I supervised her play. I was hoping it was too big to get under the couch, but no. It goes right under it. I had to block off the gap so I didn’t have to keep getting it out from under for her. The outter “shell” is very durable! When she had resting moments, she chewed it pretty good - I could hear the material squeaking against her teeth. I was worried she was tearing it up, but nope! Not a mark on it. It’s easy to set up and operate. It needed charging before play. After hours of play, she was able to somehow unscrew the outter shell. This concerned me bc the smaller, inner ball mechanism came out but I saw it right away and was able to put it back together. So, make sure it’s screwed together tightly (which I thought I had done without breaking it) and check it from time to time to make sure it hasn’t loosened. This is a great ball for her incredible high energy drive. It gives her the work and fun play she needs to get tired, which I love. This toy is on the expensive end, but so far it’s worth it. Now we’ll see how long it lasts!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 7, 2025
C
Verified Purchase
Carol D
Lowell, US
★★★★★ 5
Love love it
Color: Blue
Best dog toy ever. I have a 1 year old boxer who is full of energy (understatement). This ball has provided more entertainment for us both than any dog toy I’ve ever purchased. Charge holds well and has a very resilient shell. I love it. Worth the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
M
Verified Purchase
Megan
Lexington, US
★★★★★ 4
Great ball for limited entertainment. Replaceable outer shell is an amazing option!
Color: Blue, Color: Blue
Bought this for our 45lb, ball-obsessed Dutch shepherd/pit bull dog mix. I had one of these years ago with the hard shell and couldn’t be happier with the new foam shell. The new foam shell is much quieter and while our dog might put holes in it with his teeth, he doesn’t seem to ever pull pieces off. For engagement level, he found it VERY interesting at first and was scared to grab it, but once he got over that he started holding it in his mouth even when it shakes and just tries to keep it. Isn’t the best for fetch or anything as he has trouble letting it go when it is actively moving, but it makes him happy while he has it. We just make sure to monitor him while it is out. The ability to change the outer shell and just buy a replacement for the shell instead of a whole new toy is a lovely feature that makes me very happy to continue buying from this company.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
A
Verified Purchase
April L Patrick
Battle Creek, US
★★★★★ 5
Great Interactive Option
Color: Blue
To start, I have been very happy with this purchase. A couple of key points for me are durability and being able to keep my dog's attention. I have had it for almost a year, just a month shy, and she hasn't managed to get through the foam outer shell even though she tries real hard to do so. Let's just say, she's hard to find toys for because of her habit of finding the point of failure where she can pick and gnaw at until the toy is no longer safe for her to have. With this toy, she not only found her match, but it also has her watching, waiting, and even stalking. Only one small issue has recently occurred: the motor has started having an issue where the charge doesn't hold, and it doesn't remain on afterwards. I have reached out to Cheerble directly to see about replacing it since I am still within their 12-month timeframe, and they responded right away.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026

recommand products