SKU: 22835555651

Human BCMA/TNFRSF17 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human BCMA/TNFRSF17 Protein, His TagProduct Specification Species Human Synonyms Tumor necrosis factor receptor superfamily member 17, B cell maturation protein, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Protein sequence (Q02223 1, Met1 Ala54, with C His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Expression System HEK293 Molecular Weight Predicted MW: 5. 9 kDa Observed MW: 10, 13 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species Human
Synonyms Tumor necrosis factor receptor superfamily member 17, B-cell maturation protein, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Protein sequence (Q02223-1, Met1-Ala54, with C-His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Expression System HEK293
Molecular Weight Predicted MW: 5.9 kDa Observed MW: 10, 13 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 22835555651

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Ansley
Waukegan, US
★★★★★ 5
True to size & Use a Drill
Color: Beige, Size: 3 Panel-102‘’-Round Pad, Color: Beige, Size: 3 Panel-102‘’-Round Pad
Love this! Works perfectly for where I wanted it. I did measure my room incorrectly and thought it would be smaller, thankfully it’s not and thankfully it’s not bigger than the room itself. I did like how the whole thing was move-able but it was a bit annoying so I just added extra clips to the left of the middle one and unscrewed the right of the middle at the bottom so it opens like a door, this did make it a bit flimsy but duck taping it to the wall as anchor it works. 100% recommend, but do suggest a drill and a second set of hands to put it together, due to its size it can be a bit difficult to maneuver putting together yourself. Also if you have a clingy cat like I do, and think this will help keep them out, no, my cat who is very large can manage to squeeze underneath it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2024
S
Verified Purchase
Sam
Boise, US
★★★★★ 1
waste of money
Color: Black, Size: 4 Panel-136‘’W-Round Pad
This is a total waste of money. Its only going to free stand if you arent moving it. If you are planning on dividing a room, and then folding these for space and then dividing the room again, itll last a few days. The poles kept coming off of the screws that holds the fabric on the poles together. Was fixing this EVERY DAY. Finally got tired of doing this and just threw it out. Lot of money spent on garbage. Get a sheet room divider, or something that isnt cheaply made. Was simply making an office type space in a bedroom, to seperate the two areas for work, and folding it kept making the poles come off those twisted screws. just not worth it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
A
Verified Purchase
Alysha H.
Alexandria, US
★★★★★ 5
Absolutely love this room divider!
Color: Beige, Size: 3 Panel-102‘’-Round Pad, Color: Beige, Size: 3 Panel-102‘’-Round Pad
When they say you can't see anything through it, they are correct. As you can see by the video, the cars are traveling by with the sunlight on the divider and you still can't see any cars passing nor can you see the ones in the parking lot. You can also tell it blocks out the sunlight too which is a definite plus for our store. Quality material on the divider. Material is nice and snug on the poles with no ripples. I also like the base of these, they make the divider nice and sturdy and can be adjusted if floor is uneven. Also the design of the legs allow them to go under your furniture. Also putting them together is pretty easy. Just make sure you when you are putting the poles together to make sure at the top of the pole that the indent screw hole faces out. This makes for a better look. The directions don't say which way to turn and at 1st, I had one, one way and the other was another way as both ways work that way but I wanted a uniform/better look.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 29, 2024
B
Verified Purchase
B. R. Grande
Battle Creek, US
★★★★★ 4
Works well, need power tool to assemble
Color: Beige, Size: 3 Panel-102‘’-Round Pad, Color: Beige, Size: 3 Panel-102‘’-Round Pad
Sturdy enough, especially when feet are positioned for balance. Works perfectly to create a WFH “cubicle”. Can adjust the size to provide complete privacy or fold back a panel when I want more openness. The fabric panels are not perfectly taught, but pretty close. The only negative is that without my husband’s power drill/screwdriver we wouldn’t have been able to put it together. It would take the strength of Thor to do it with just a manual screwdriver.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2022
C
Verified Purchase
Cynthia Ross
San Leandro, US
★★★★★ 5
Now I don't have to see the "black hole" that used to be my family room!
Color: Black, Size: 4 Panel-136‘’W-Round Pad
I have an adult child living at home and his bedroom is tiny, so he's pretty much taken over the family room. We are both much happier now that the divider is up. It is about 12 feet long and gives him privacy to watch his movies and play his video games. And I don't have to see all the shoot-em-up stuff he likes to watch. I put the divider together with just a screwdriver (not a power one, that would be nice but I don't have so I had to use a little elbow grease.) It took a couple hours. The instructions are straightforward. I did have to use my long dining room table to attach the feet to the divider panels, which was a bit tricky. But I'm really pleased with the end result. I'm NOT a handywoman, so I feel proud that I did it "all by myself." He wanted the black fabric, but I think the lighter colors would have been better for a room that gets hot in the summer. Just my opinion. Whatever color you choose, I think you'll like the end result.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2023

recommand products