SKU: 23007584350

ALK-1/ACVRL1 His Tag Protein, Human

Sale price$266.40 Regular price$296.00
Save 10%

Pay in installments of $74.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ALK-1/ACVRL1 His Tag Protein, HumanProduct Specification Species Human Synonyms HHT, HHT2, ORW2, SKR3, TSR I Accession P37023 Amino Acid Sequence Asp22 Gln118, with C terminal 8*His DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQGGGSHHHHHHHH Expression System HEK293 Molecular Weight 22 28kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Synonyms HHT, HHT2, ORW2, SKR3, TSR-I
Accession P37023
Amino Acid Sequence

Asp22-Gln118, with C-terminal 8*His

DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 22-28kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Cindy Lora Gil. Bruno Larrivée. Alk1haploinsufficiency causes glomerular dysfunction and microalbuminuria indiabetic mice. ScientificRepoRtS (2020) 10.


Background

The Bone Morphogenetic Protein (BMP) receptor activin receptor–like kinase 1 (Alk1), which is predominantly expressed in the vascular endothelium, has been shown to play a critical role in angiogenesis. Embryos lacking Alk1 die early during embryonic development due to impaired vascular remodeling and lack of perivascular cell coverage. In renal physiology, Alk1 has been suggested to play an important role in the regulation of extracellular matrix deposition, including collagen type I and fibronectin, and Alk1 heterozygosity has been associated with increased renal fibrosis in a mouse model of obstructive nephropathy, probably due to the decrease in the Alk1/Smad1 antifibrotic/protective signaling in renal fibroblasts.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23007584350

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
E
Verified Purchase
eshayer
Louisville, US
★★★★★ 5
Perfect beater
Size: 12 Wide, Color: Army Green, Size: 12 Wide, Color: Army Green
I’m pretty happy with this hiking shoes. It is confy, well made and sturdy. First impressions were all positive. I was looking for a beater that I wouldn’t feel sorry to abuse, and this is the perfect fit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 22, 2026
J
Verified Purchase
Justin Jolley
Carnegie, US
★★★★★ 5
Versatile, comfortable and a delight to wear
Size: 10.5 Wide, Color: Army Green
Had never heard of this brand but needed a pair of waterproof boots for a trip to the PNW where we would hike in mountains, rainforest and beaches. I have a pair of Merrell Moab hiking shoes, but wanted something that covered more and were waterproof. These boots are amazing. They are one of the most comfortable shoes I own. I wore them everywhere and found I preferred them over other shoes throughout the trip. They stayed comfortable and dry no matter where we went, rivers, lakes or the ocean. I’ve now worn them on several trips including a March trip to Bryce Canyon where we went from snow on some trails to the heat of the red rocks in others. I love these boots more every time I wear them. I am a huge fan now. At the price they are a nobrainer. I would buy these Nortiv8 boots over and over again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
K
Verified Purchase
kaniksu
Lake Worth, US
★★★★★ 4
Good value for a $55 boot.
Size: 12, Color: Army Green
I like these boots because I have a wide foot and even though I bought the 12 and NOT the 12W there is plenty of width. Very comfortable boot. I have put this pair through about 1000 miles mostly on asphalt, ice and snow. Very little actual dirt/ rocky trails. I bought them for the waterproofness and ankle support. Now the soles are getting thin and I can feel small rocks through the soles. Plus the soles are beginning to separate from the uppers and they are no longer waterproof. Not bad for 1000 miles. Still, I feel For a $55 boot they are a good value. I am 6ft and weigh 250.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
J
Verified Purchase
Jorgeh
Grantham, US
★★★★★ 5
Very comfortable
Size: 11, Color: Army Green
Great boots , comfort, fits great!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
R
Verified Purchase
Renny
Alexandria, US
★★★★★ 5
Worth Every Penny!
Size: 9, Color: Coyote
I absolutely love these boots! They are super light, comfortable and definitely waterproof. I took them on a camping trip for the weekend and I walked through creeks and puddles with no issues at all. No water got inside and they were comfortable all weekend. The only thing was the tongue did start to bother me a bit after the 3rd day. I have some pretty boney shins but a small cloth between my shins and the tongue helped a lot.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026

recommand products