SKU: 23338618759

Parvalbumin His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Parvalbumin His Tag Protein, HumanProduct Specification Species Human Antigen Parvalbumin Synonyms PVALB, D22S749 Accession P20472 Amino Acid Sequence Met1 Ser110, with N terminal 8*His HHHHHHHHMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES Expression System E. coli Molecular Weight 16kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer

Product Specification


Species Human
Antigen Parvalbumin
Synonyms PVALB, D22S749
Accession P20472
Amino Acid Sequence

Met1-Ser110, with N-terminal 8*His HHHHHHHHMSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAES

Expression System E.coli
Molecular Weight 16kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Virchows Arch. 2021 Apr;478(4):785-791. Epub 2020 Jun 10.

Background

Parvalbumin is a cytosolic calcium-binding protein expressed in the distal convoluted tubule of the renal nephron that is structurally and functionally similar to calmodulin and troponin C. Among epithelial renal tumors, the reactivity for parvalbumin is observed in chromophobe renal cell carcinomas and frequently in oncocytomas. This protein is thought to be involved in muscle relaxation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23338618759

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Cyclegreen
Bozeman, US
★★★★★ 5
Great for kids
Color: Lightgreen
The HUACOCARE Kids Water Flosser and Electric Toothbrush Combo is an absolute game-changer for establishing a solid dental hygiene routine with children. The light green giraffe and monkey design is incredibly charming and immediately turned what used to be a bedtime struggle into a fun activity that my child actually looks forward to. Having both the sonic toothbrush and the water flosser in one compact unit is brilliant, as it saves counter space while ensuring that every part of their mouth gets a professional-level clean. The three gentle flossing modes and two sonic brushing modes are perfectly calibrated for younger, more sensitive gums, providing a thorough clean without any discomfort. One of the standout features of this set is how braces-friendly it is; the water flosser reaches those tricky spots around wires and brackets that a standard toothbrush simply can't touch. It is clear that a lot of thought went into the ergonomics and the "fun factor," making it a perfect gift that is both practical and engaging. Since we started using this combo, our dentist has noticed a significant improvement in plaque removal and overall gum health. If you are looking for an all-in-one solution to build healthy brushing habits and make dental care feel like less of a chore, this set is worth every penny.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 21, 2026
E
Verified Purchase
Elizabeth
Cuba, US
★★★★★ 5
I would recommend.
Style: 10,000iu, Size: 90 Count (Pack of 1)
The NatureWise Vitamin D3 10,000 IU is a high-quality supplement that’s easy to take and seems to be effective. The softgels are small and smooth, making them easy to swallow. I like that it supports overall immune health and energy levels. The bottle lasts a good amount of time, and the quality feels reliable. Overall, a solid Vitamin D3 supplement that I would recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
R
Verified Purchase
Russell Boulet
Fort Morgan, US
★★★★★ 5
Per my doctor’s suggestion
Style: 1000IU, Size: 360 Count (Pack of 1)
My doctor advised me that I needed to take vitamin D3 daily in this dose. The gel capsules are really small and easy to swallow. After checking around, I felt that this was the Best Buy for my buck. And NatureWise has a good reputation for quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
N
Verified Purchase
NegativeG
Battle Creek, US
★★★★★ 5
Good value, easy to take, and great quality
Style: 2000IU, Size: 360 Count (Pack of 1), Style: 2000IU, Size: 360 Count (Pack of 1)
I bought these because my doctor recommended Vitamin D3 for overall health and immunity. I’ve tried a few different brands before, and this one stood out as a good balance of quality and value, especially with the 360-count bottle that will last a full year. Compared to other brands I’ve used, these softgels are equally small and easy to swallow, and the 2000 IU dosage matches what my doctor recommended. I haven’t had any issues with the capsules sticking together, and there’s no noticeable taste or aftertaste. Overall, a great purchase, and I plan to keep buying.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
D
Verified Purchase
David Del Valle
Belleville, US
★★★★★ 5
Good value for the money
Style: 5000IU, Size: 360 Count (Pack of 1)
Odor was not detectable, gentle on the stomach and easy to digest, double check before taking this supplement; it may interact with certain medications, otherwise an excellent product. Good value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026

recommand products