SKU: 23445676197

Human PTH , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PTH , His tagProduct Specification Species Human Synonyms Parathormone, Parathyrin Accession P01270 Amino Acid Sequence Protein sequence(P01270, Ser32 Gln115, with C 10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 11. 1kDa Actual: 12kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder

Product Specification


Species Human
Synonyms Parathormone, Parathyrin
Accession P01270
Amino Acid Sequence Protein sequence(P01270, Ser32-Gln115, with C-10*His) SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:11.1kDa Actual:12kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months.

-20 to -70 °C under sterile conditions after reconstitution.

1 week, 2 to 8 °C under sterile conditions after reconstitution.

Please avoid repeated freeze-thaw cycles.

Background

Parathyroid hormone (PTH), also called parathormone or parathyrin, is a peptide hormone secreted by the parathyroid glands that regulates the serum calcium concentration through its effects on bone, kidney, and intestine. PTH influences bone remodeling, which is an ongoing process in which bone tissue is alternately resorbed and rebuilt over time. PTH is secreted in response to low blood serum calcium (Ca2+) levels. PTH indirectly stimulates osteoclast activity within the bone matrix (osteon), in an effort to release more ionic calcium (Ca2+) into the blood to elevate a low serum calcium level. Disorders that yield too little or too much PTH, such as hypoparathyroidism, hyperparathyroidism, and paraneoplastic syndromes can cause bone disease, hypocalcemia, and hypercalcemia.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 23445676197

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Gabriel Cruz
Lake Worth, US
★★★★★ 3
Some errors, binding frightens me, story is good.
Format: Hardcover, Format: Hardcover
This hardcover collects Street Fighter Unlimited #1-4 of the ongoing series. The pages are not loose but you can see the binding very easily which frightened me a little on how I turned the pages. There are some grammatical errors that I started catching, I wish the editing team would have spent a little more time on it. I asked several people if what I read was correctly. I took a picture of one example of it as you can see on the attached pictures of the review. The story is basically Ryu, the Wandering Warrior questioning himself and seeking answers as he seeks balance. We learn of Gil's "Secret Society" and it leaves us with a cliff hanger. There was another story included that I had no idea where in the story it fit. It just gave me a "huh" moment. I look forward to reading Vol. 2 soon.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 3, 2024
C
Verified Purchase
Consumer
Louisville, US
★★★★★ 5
a must-have for X-Men 97 fans
Format: Hardcover
quality is stunning, the art is so beautiful and beyond expectations. highly recommend, an absolute MUST HAVE FOR XMEN 97 FANS! cannot say enough nice things about this gorgeous book
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2025
A
Verified Purchase
Amazon Customer
West Palm Beach, US
★★★★★ 5
Fun read
Format: Hardcover
Great book 📖. 💚
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
R
Verified Purchase
R. Strickland
Belleville, US
★★★★★ 5
It's as good as you hope it will be
Format: Hardcover
Beautiful book, really enhances my enjoyment of the show. Find a review flip-through video. If that looks good to you, there's no way you'll be disappointed. If you're thinking of this as a gift, yes, it's a great one. The show is peak X-men, and the quality is to last the ages. All that comes through in the book, just a wonderful, loving production, of the best Marvel Studios has to offer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 14, 2025
A
Verified Purchase
Amazon Customer
Alexandria, US
★★★★★ 5
Amazing!
Format: Hardcover
Love the quality and all the inside stories of the show. Everything was great! Thanks!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 19, 2026

recommand products