SKU: 24015042741

Human NY-BR-1, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NY-BR-1, His tagProduct Specification Species Human Synonyms ANKRD30A Accession Q9BXX3 Amino Acid Sequence Protein sequence(Q9BXX3, Arg851 Leu928, with C 10*His) RMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFPSESKQKKVEENSWDSESLGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 10. 6kDa Actual: 13 20kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m

Product Specification


Species Human
Synonyms ANKRD30A
Accession Q9BXX3
Amino Acid Sequence Protein sequence(Q9BXX3, Arg851-Leu928, with C-10*His) RMKVSIPTKALELMDMQTFKAEPPEKPSAFEPAIEMQKSVPNKALELKNEQTLRADQMFPSESKQKKVEENSWDSESLGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:10.6kDa Actual:13-20kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

ANKRD30A has been previously identified as NY-BR-1 or antigen B726P. It was identified based on spontaneous humoural immune responses in breast cancer patients (Jäger et al. 2001, 2002). The protein is regarded as a putative transcription factor, as it contains a bipartite nuclear localization signal motif and a bZIP site (DNA-binding site followed by leucine zipper motif). Additional structural features include five tandem ankyrin repeats, implying a role for ANKRD30A in protein–protein interactions. In view of its highly restricted expression pattern, ANKRD30A may be considered as a breast differentiation antigen that could represent a suitable target for immunotherapy. Indeed, it was found in 80% of breast cancer specimens, while tumours of other histological types were ANKRD30A-negative. It was also identified in normal breast, normal testis, was inconsistent in prostate, and not found in other tissues.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24015042741

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Terra Todd
Houston, US
★★★★★ 5
Not for older skib
Color: Medium Sunlight
This is very nice but settles into fine lines
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 16, 2025
A
Verified Purchase
Ayesha Yasmin
Battle Creek, US
★★★★★ 5
A protective formula that protects and radiates skin all day
Color: Light Beige
I like the pressed foundation for smooth and bright look on face.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 23, 2025
J
Verified Purchase
Jessica Littleton
Lexington, US
★★★★★ 5
Azelaic Acid Sunscreen A MUST!!!! BEST sunscreen!!!
Style: Acne/Rosacea Prone Skin
Finally!!!!! I have found a sunscreen that actually helps my skin!! I have tried so so so many! Around 25 different types! From $-$$$$! This one is so great! It is still a sunscreen and feels a bit of a sunscreen at first but once it has set it is amazing! I would absolutely recommend! I have acne prone, dry, sensitive skin and this has not broken me out isn't heavy and hasn't inflamed my skin. It has actually improved my skin. I like the lower list of ingredients as well. I use Retin-a 0.1% (at night) and use a moisturizer AM&PM (person and covey DMl) under this. I would say it isn't a stand alone moisturizer. Would recommend this! And will be buying another one once this one is out! Pros: Liquid/watery consistency Minimal ingredient list Works great with makeup Layers nicely No white cast Easy to remove Nice packaging Good price point Great for acne/acne prone skin Flaky skin approved Not shiny Actually helped my skin Azelaic acid Cons: Slightly like applying sunscreen at first
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 9, 2025
J
Verified Purchase
Jasmine
Natrona Heights, US
★★★★★ 5
Great product
Style: Acne/Rosacea Prone Skin
Really love this sunscreen. I was using shiseido before which has a nice texture but this one I honestly think is better. It doesn’t burn my eyes when I’m at the gym like other sunscreen too. Don’t usually need to wear a moisturizer with it because it is moisturizing, but I guess some people may consider a con depending on what you’re looking for. I am a super oily girl in general and I would say if you are sensitive to that then maybe try one of their more mattifying ones which I plan to do after I run out of this one. Otherwise, I don’t think I will change brands for SPF after trying this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
L
Verified Purchase
Luz mery Bolivar
Los Angeles, US
★★★★★ 5
Great on skin
Style: Acne/Rosacea Prone Skin
Great and not oily
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026

recommand products