SKU: 24293537824

Human IL-3, his tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-3, his tagProduct Specification Species Human Synonyms Hematopoietic growth factor, Mast cell growth factor (MCGF), Multipotential colony stimulating factor, P cell stimulating factor Accession P08700 Amino Acid Sequence Protein sequence (P08700, Ala20 Phe152, with C 10*His) APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIFGGGGSHHHHHHHHHH Expression System HEK293 Molecular

Product Specification


Species Human
Synonyms Hematopoietic growth factor, Mast cell growth factor (MCGF), Multipotential colony-stimulating factor, P-cell-stimulating factor
Accession P08700
Amino Acid Sequence

Protein sequence (P08700, Ala20 - Phe152, with C-10*His) APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIFGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 16.8 kDa Observed MW: 18-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interleukin 3 (IL-3) is a protein that in humans is encoded by the IL3 gene localized on chromosome 5q31.1. Sometimes also called colony-stimulating factor, multi-CSF, mast cell growth factor, MULTI-CSF, MCGF; MGC79398, MGC79399: the protein contains 152 amino acids and its molecular weight is 17 kDa. IL-3 is produced as a monomer by activated T cells, monocytes/macrophages and stroma cells. The major function of IL-3 cytokine is to regulate the concentrations of various blood-cell types. It induces proliferation and differentiation in both early pluripotent stem cells and committed progenitors. It also has many more specific effects like the regeneration of platelets and potentially aids in early antibody isotype switching.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 24293537824

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Massapequa, US
★★★★★ 5
Great to keep your dog entertained
Color: Blue
Great toy my 13 month old cane corso absolutely loved it and it kept her entertained forever except she has an extremely strong bite so she was figuring out a way to split it apart so I had to take it away -it’s extremely strong, but not strong enough for the bite of a cane corso but any other dog would love it. I just wish my dog didn’t have such a strong bite and would be able to keep enjoying it since it is a little expensive the only problem with it is that I thought the remote shuts it off, but then her bites were making it come back on, so I don’t know if it was my dog or the toy just doesn’t stay off until you turn it on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2026
V
Verified Purchase
Valerie
Lexington, US
★★★★★ 1
Stopped working within 3 days
Color: Blue
Worked for 3 plays. My 11 week old puppy loved this item. Unfortunately, it only lasted 3 tries before the motor stopped working. $30 for a total of 30 minutes over 3 days is robbery! I'd look at another vendor for the same type of item. We charged it after each attempt but now the motor won't turn on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026
M
Verified Purchase
M Girven
Lexington, US
★★★★★ 3
Item was returned
Color: Blue
Used it one day and partially the following day. Put on charger. Never worked again. My dog played with it but returned it as defective.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
L
Verified Purchase
L
Carnegie, US
★★★★★ 4
Not for super chewers
Color: Blue
This ball seems to be of good quality; has held a charge well and is easy to use. Sadly, the cover lasted less than 15 minutes with our dog.... not for aggressive chewers for sure. Pretty funny to watch the hound dog jowls shake though.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 25, 2026
J
Verified Purchase
Jessica S.
West Palm Beach, US
★★★★★ 5
Great fun for dogs!
Color: Orange
Two of our dogs really love this! It caused a lot of barking and chasing and running around trying to grab it. It's really funny to use the remote to control it (and especially make it stop when things get a little too chaotic!) It feels durable even when pawed and bumped into and stepped on. The battery life seems good. I plugged it in overnight to charge so not sure how long it took to charge, but it has lasted quite a while with the dogs playing with it and still doesn't need a charge. It's easy to screw off one side of the ball to plug it in to charge. The size is a little bigger than a tennis ball I would say and has a soft texture.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 6, 2026

recommand products