Pay in installments of $65.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Sep 1 - Sep 6
For Your Every Summer RSVP, with Code: SUMMER15
Description
CEACAM-5/CD66e His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CEACAM 5, CD66e, CEA, Meconium antigen 100 Accession XP_005589491. 2 Amino Acid Sequence Gln35 Gly685, with C terminal 10* His
Product Specification
| Species | Cynomolgus |
| Synonyms | CEACAM-5, CD66e, CEA, Meconium antigen 100 |
| Accession | XP_005589491.2 |
| Amino Acid Sequence | Gln35-Gly685, with C-terminal 10* His QLTIESRPFNVAEGKEVLLLAHNVSQNLFGYIWYKGERVDASRRIGSCVIRTQQITPGPAHSGRETIDFNASLLIHNVTQSDTGSYTIQVIKEDLVNEEATGQFRVYPELPKPYISSNNSNPVEDKDAVALTCEPETQDTTYLWWVNNQSLPVSPRLELSSDNRTLTVFNIPRNDTTSYKCETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGENLNLSCHAASNPAAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTAITVYAELPKPYITSNNSNPIEDKDAVTLTCEPETQDTTYLWWVNNQSLSVSSRLELSNDNRTLTVFNIPRNDTTFYECETQNPVSVRRSDPVTLNVLYGPDAPTISPLNTPYRAGENLNLSCHAASNPAAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTAITVYVELPKPYISSNNSNPIEDKDAVTLTCEPVAENTTYLWWVNNQSLSVSPRLQLSNGNRILTLLSVTRNDTGPYECGIQNSESAKRSDPVTLNVTYGPDTPIISPPDLSYRSGANLNLSCHSDSNPSPQYSWLINGTLRQHTQVLFISKITSNNNGAYACFVSNLATGRNNSIVKNISVSSGDSAPGSSGGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 97-170kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Hammarstrom S. (1999) The carcinoembryonic antigen (CEA) family: structures, suggested functions and expression in normal and malignant tissues. Seminars in Cancer Biology. 9(2): 67-81. |
Background
The human CEA family has been fully characterized. It comprises 29 genes of which 18 are expressed; 7 belonging to the CEA subgroup and 11 to the pregnancy specific glycoprotein subgroup. CEA is an important tumor marker for colorectal and some other carcinomas. The CEA subgroup members are cell membrane associated and show a complex expression pattern in normal and cancerous tissues with notably CEA showing a selective epithelial expression. Several CEA subgroup members possess cell adhesion properties and the primordial member, biliary glycoprotein, seems to function in signal transduction or regulation of signal transduction possibly in association with other CEA sub-family members.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.2 ★★★★★
Based on 11 reviews
Sort
Product Reviews
★★★★★ 5
Much Needed Cabin Air Filter Replacement!
This Cabin air filter replacement is working well. It had been a long time since I replaced my cabin filter, so this was a much needed replacement. It was easy to do, and a much needed replacement. The air quality inside my car is much better. It smells fresh, and light and airy now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
★★★★★ 5
Great quality and noticed an immediate difference!
Style: BE-966H 1-Pack
Even though it’s not the OEM (original) filter, the quality is outstanding! It was easy to install and fits perfectly. I noticed a significant improvement in the air quality inside my car right away. Definitely a great buy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
★★★★★ 5
Easiest DIY ever
Style: BE-157H 1-Pack
So a Toyota dealer will want $40+ to replace this filter, but for $10 and 2mins you can easily do this yourself.
There’s a great 1:30 how-to vid on the YouTube, drop the glove box (one push) open the little door, remove old filter (note the arrow) and put in the new one, close door, close glove box, enjoy better flow and fresh air. This filter is a HEPA so it’s a performance upgrade over the OEM, fit is perfect, seems sturdier than the OEM, great value if you’ve got 2mins.
Highly recommend. Thanks!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 23, 2025
★★★★★ 5
Awesome Cabin Air Filter
Style: BE-151H 1-Pack
This product is not only cost efficient, it was also easy to install. The instructions in the package were helpful. I would definitely recommend using this filter for your 2017 Hyundai Sonata.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2026
★★★★★ 4
the "fit" is very precise
Style: BE-176H 1-Pack
Nice Fabrication, Good materials, perfect adhesive applications, "clean joints" etc.
Appears to be a good UPGRADE from the stock Motorcraft product.
CONs: The FIT was a "smidge TIGHT", and took very precise initial alignment and "pressure" to begin to slide into the rectangular hole. I measured the "Hole" at 7.375" wide, or (187.33 mm)... the FILTER is exactly the SAME.
I would suggest maybe reducing the Width by 1 mm, to allow for an easier installation.
The MOTORCRAFT uses an "open-cell" foam structure for the (2) Side pieces on their filter assembly, allowing some "compression to fit", of the Width, easing the difficulty of installation, yet still filling all voids.
In summation, the "fit" is very precise. Not to be hurried or rushed, maybe a bit meticulous for the impatient or weak of heart.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2025