SKU: 78221382079

CEACAM-3/CD66d His Tag Protein, Human

$279.00 $310.00
Save 10%
No.2 Bestseller on lamcf.fr >

Pay in installments of $77.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CEACAM-3/CD66d His Tag Protein, HumanProduct Specification Species Human Synonyms CEACAM3, CD66d, CEA, carcinoembryonic antigen related cell adhesion molecule 3, CGM1, W264, W282 Accession P40198 Amino Acid Sequence Lys35 Gly155, with C terminal 8*His KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 24kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Human
Synonyms CEACAM3, CD66d, CEA, carcinoembryonic antigen-related cell adhesion molecule 3, CGM1, W264, W282
Accession P40198
Amino Acid Sequence Lys35-Gly155, with C-terminal 8*His KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 20-24kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Schmitter T. et al. (2007) The Granulocyte Receptor Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) Directly Associates with Vav to Promote Phagocytosis of Human Pathogens. The journal of immunology. 178: 3797-3805.

2、Swanson K V. et al. (2001) CEACAM is not necessary for Neisseria gonorrhoeae to adhere to and invade female genital epithelial cells. Cellular Microbiology. 3(10): 681-691.

Background

Carcinoembryonic Antigen-related Cell Adhesion Molecule 3 (CEACAM-3), or CD66d, is part of the CEA protein family consisting of CEACAMs and the pregnancy-specific glycoproteins (PSGs). Both CEACAM and PSG molecules have been identified in humans and belong to the much larger glycosylphosphatidylinositol (GPI)-linked immunoglobulin (Ig) superfamily. Human CEACAM-3 is ~35 kDa, consisting of an extracellular domain (ECD) containing one IgV-like domain, a single transmembrane domain and a cytoplasmic tail. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis. CD66d antibody increases neutrophil adhesion to the monolayer of human umbilical vein endothelial cells.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 78221382079

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Broomfield_CO
Grantham, US
★★★★★ 5
Perfect for 2014 328i GT
Very sturdy and high quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2025
T
Verified Purchase
Tammy
Grantham, US
★★★★★ 5
Happy
Fits perfectly good purchase
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 20, 2025
J
Verified Purchase
Jackbooted thug
Fort Morgan, US
★★★★★ 5
Meets the Specifications for VW TDI
Size: 1 Quart Pack of 6
I don’t get too excited about motor oil; it just needs to meet the specifications for the application. This oil meets the standards for VW TDI engines (VW 504.00 & 507.00) and several other European turbo diesel engines. While this type of oil is locally available, it is very costly if purchased locally by the quart. There are plenty of other brands like Liqui Moly and Mobile One that offer oils which will meet the specifications, so pick the one you like. After some research, I found there are no great deals in terms of cost, all of the oils that meet the VW 504.00 & 507.00 specifications are going to be on the expensive side. However, Castrol is the brand used by VW, so if that’s important to you, there’s your option. I have used this type of oil for several years and many thousands of miles with zero issues. If you do your own maintenance, you might as well save a little money and buy in bulk. Storage and shelf life of motor oil is not a concern.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 30, 2025
D
Verified Purchase
David G.
Lowell, US
★★★★★ 5
Good 507 oil
Size: 5 Quarts, Pack of 3
Great rated VW/Audi 507 oil for diesel Provides low, SAPS to protect your DPF
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
M
Verified Purchase
Matt
West Palm Beach, US
★★★★★ 5
Great oil for BMWs
Size: 1 Quart Pack of 6
Not much too say, it's the classic oil, only thing I can note is that it came with the old packaging and all that, but it works great for my car and runs smooth and without noises or temps, good value, and fairly fast shipping, good thing I can find it on here because none of my local auto stores had it on stock.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2025

recommand products

Scarabottolo | Senza titolo | 25 x 25 cm | (MINISCA 44)
60.00
Arca Pressure Balance Valve Trim - Brushed Gold TAA51BG RIOBEL
176.00
Luigi Belli | Madrigali | 12
240.00
Francesco Bocchini | Appunti e Frammenti | 11 | Seduto
170.00
CS 5-Functions Thermostatic Valve Trim - Brushed Nickel TCSTM45BN RIOBEL
229.56