SKU: 25989675168

Rat GH Protein, His tag

$180.00 $200.00
Save 10%
No.2 Bestseller on lamcf.fr >

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rat GH Protein, His tagProduct Specification Species Rat Synonyms Somatotropin, Growth hormone, Gh1, Gh Accession P01244 Amino Acid Sequence Protein sequence (P01244, Phe27 Phe216, with C His tag) FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF Expression System HEK293 Molecular Weight Predicted MW: 23. 5 kDa Observed MW: 23. 5 kDa

Product Specification


Species Rat
Synonyms Somatotropin, Growth hormone, Gh1, Gh
Accession P01244
Amino Acid Sequence

Protein sequence (P01244, Phe27-Phe216, with C-His tag) FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF
Expression System HEK293
Molecular Weight

Predicted MW: 23.5 kDa Observed MW: 23.5 kDa
Purity ＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.05M Tris-HCl, pH9.5.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Growth hormone (GH) is a peptide hormone that stimulates growth, cell reproduction, and cell regeneration in humans and other animals. GH also stimulates production of insulin-like growth factor 1 (IGF-1) and increases the concentration of glucose and free fatty acids. It is a type of mitogen which is specific only to the receptors on certain types of cells. GH is a single-chain polypeptide that is synthesized, stored and secreted by somatotropic cells within the lateral wings of the anterior pituitary gland.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 25989675168

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
saitta Juliana
Waukegan, US
★★★★★ 4
Great frother
Color: Matte Black
It makes a great milk froth and heats well. One thing however, in spite of respecting the line limit it spills out and you have to clean the whole thing. So don’t fill it up to the line limit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
S
Verified Purchase
Sina Nabavi
San Leandro, US
★★★★★ 5
Thick foam for Cappuccinos
Color: White-Stainless, Color: White-Stainless
Comes with sevaral options including thin and thick foam, hot milk and cold foam. I used the thick foam for cappuccinos and I was impressed by the consistency. Not so much noise and easy to clean. The frother tools come off easily for cleaning the pitcher.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
W
Verified Purchase
writer49
Port Orchard, US
★★★★★ 3
Very slow--5+ minutes to froth and warm milk
Color: White-Stainless
Pros-- Makes nice froth and warms the milk. Both froth settings produce the same kind of froth. it's relatively easy to clean-- usually just a strong rinse will do. It does fine in the dishwasher too. The noise level isn't bad. Cons--it takes between five and six minutes to froth milk. It is very slow. I can froth latte art milk on my espresso maker in less than a minute, by comparison. The forth it produces is too thick to make any kind of latte art.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
M
Verified Purchase
Mariel soler
Birmingham, US
★★★★★ 5
Quality
Color: White-Stainless
What really impressed me is how fast it works—in just a couple of minutes, I have hot, creamy milk with thick, rich foam. The texture comes out smooth and fluffy, just like a coffee shop. It’s super easy to use, and cleaning it is quick too. I’ve used it for lattes, cappuccinos, and even hot chocolate, and it works perfectly every time. Definitely worth it if you want something quick, easy, and makes great foam in large amounts
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 24, 2026
T
Verified Purchase
TwoPennyKindles
Grantham, US
★★★★★ 5
Very nearly perfect!
Color: Matte Black
Admittedly, I'm writing this after making only one latte, but it was almost perfect! The milk was hot enough, but not too hot. The froth on my half & half was luxurious. It was super easy to use and select the what I want. I love the glass pitcher and being able to see my half & half as it heats and foams up. The only thing that isn't perfect, and I didn't take any off on my stars for, is that the frother is plastic. I'm striving for a plastic-free life and this Milk Frother and Steamer is very close to that, but heating plastic releases nanoparticles into the contents. I may have to buy another one, since it seems that there is no spare pitcher available to buy. Two pitchers would be very handy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products

14k White Gold 9.5mm Tahitian Pearl Stud Earrings GER-23506
349.50
The Walking Dead: Dead City License to Survive Souvenir Pint Glass
24.03
vampire slayer "hoodie"
190.00
The Walking Dead: The Ones Who Live Rick & Michonne Wooden Ornament
15.35
Cloakroom Suite - Slimline Vanity Unit, Tap and Toilet - Electric Blue/Chrome
250.00