SKU: 28966337503

Human Lumican, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Lumican, His tagProduct Specification Species Human Synonyms Keratan sulfate proteoglycan lumican (KSPG lumican) Accession P51884 Amino Acid Sequence Protein sequence(P51884, Gln19 Asn338, with C 10*His)

Product Specification


Species Human
Synonyms Keratan sulfate proteoglycan lumican (KSPG lumican)
Accession P51884
Amino Acid Sequence

Protein sequence(P51884, Gln19-Asn338, with C-10*His)
QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 38.3kDa Actual: 46kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Lumican is a member of the small leucine-rich proteoglycan family. It is present in numerous extracellular matrices of different tissues, such as muscle, cartilage, and cornea. In skin, lumican is present as a glycoprotein. It plays a critical role in collagen fibrillogenesis, as shown by knocking out of its gene in mice. A direct link between lumican expression and melanoma progression and metastasis has been demonstrated. Lumican was shown to impede tumour cell migration and invasion by directly interacting with the α2β1 integrin. In addition, an active sequence of the lumican core protein, called lumcorin, was identified as being responsible for inhibition of melanoma cell migration. Lumican was also shown to exert angiostatic properties by downregulating the proteolytic activity associated with endothelial cell membranes, particularly matrix metalloproteinase (MMP)-14 and MMP-9. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 28966337503

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Aidan
Dallas, US
★★★★★ 4
Difficult to assemble, but a good basic divider
Color: Beige, Size: 22"- 4 Panel
I bought this to use as a background for when I have video calls. I wish I'd ordered the 6- or even 8-panel to block a little more, but that's my own error. It still covers a good portion of the room, so I'll make do, or maybe buy another at a later date to expand it. It looks ok, if a little plain. The fabric panels have creases in them from being folded and will need to be steamed or ironed out for a nicer look. It would be easy to make your own panels as well, if you're so inclined. The construction is decent. The frame is lightweight and if you don't angle the base supports the right way it may tip over if you extend it too far. The fabric panels aren't the highest quality, but are sturdy enough. They seem like they would handle being thrown in the wash well. The only issue I have with it is that it was so difficult to put together. The push latches that connect the poles don't push it well and hurt my hands. The fabric panels are sized to be extremely taut, which makes it very difficult to get them on the bars without forcing the bar to bend slightly. Overall, this is a good divider if you're looking for something simple and functional without being too worried about aesthetic. It's also a good, inexpensive base if you want to make your own custom panels.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 5, 2025
D
Verified Purchase
DollarBill
San Leandro, US
★★★★★ 5
Great Room divider
Color: Beige, Size: 34"- 3 Panel
Works well in separating my kids play area from my computer/office room. Easy to put together, height is perfect somewhat sturdy, looks great, light weight, not good if you are using it as a door, but if it is to stay in place than it is stable enough.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2025
Z
Verified Purchase
zakah123
Lexington, US
★★★★★ 5
Exactly what I needed
Color: Black, Size: 34"- 3 Panel, Color: Black, Size: 34"- 3 Panel
It was easy to put together even without a power drill. Completely opaque. Only a very small slit between poles. I plan to add black electrical tape, but that's because I don't want nosies peeking through to see my screen. The height is beautiful. I was afraid it wouldn't be as tall as I needed. But it is perfect. I share a small office with a good buddy of mine. People passing by our door is distracting and invites them to speak to me. I needed something that would stop the former and prevent the latter, especially when I'm deep in concentration mode. The two panels are enough to block outsiders and the third panel I will employ when I can't even be disturbed by my officemate. It's the fastest and easiest signal not to disrupt me at all. 10/10
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 3, 2025
M
Verified Purchase
mrcricket
Lowell, US
★★★★★ 3
Packaging contents
Color: Grey, Size: 34"- 3 Panel
Item is as described however this one appeared to be open and some parts possibly used. Example pole packaging mislabeled one had the letter K as a part there is no letter K item in the instructions. Another pole part had a taped on letter A which is completely different from the others thus indicating that it was opened or substituted. Finally after the partition was completely put together one of the bottom screw connection anchors came out making the partition unable to stand. I'm going to have to rig something up in order to get the anchor connected to the bottom panel. In closure the partion could be very acceptable and do the job if it was new and parts labeled correctly. I have pictures of all parts and packaging errors. Would buy again if new. I'm going to pursue some kind of compensation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 15, 2026
W
Verified Purchase
Wendy Gray
New York, US
★★★★★ 5
Great product
Color: Grey, Size: 34"- 6 Panel
This room divider is great. It was easy to put together. I was worried about it standing up right and not falling over. It stays up perfectly and is very easy to move and adjust to the shape I want it. Also, from one of the videos I watched it looked like the fabric was puckered in the panels. That is not the case at all. The fabric fits tightly in each panel for a nice smooth look. I would definitely recommend this and would buy again if needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2025

recommand products