Human Lumican, His tag
SKU: 28966337503

Human Lumican, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 8 - Jul 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Lumican, His tagProduct Specification Species Human Synonyms Keratan sulfate proteoglycan lumican (KSPG lumican) Accession P51884 Amino Acid Sequence Protein sequence(P51884, Gln19 Asn338, with C 10*His)

Product Specification


Species Human
Synonyms Keratan sulfate proteoglycan lumican (KSPG lumican)
Accession P51884
Amino Acid Sequence

Protein sequence(P51884, Gln19-Asn338, with C-10*His)
QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 38.3kDa Actual: 46kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Lumican is a member of the small leucine-rich proteoglycan family. It is present in numerous extracellular matrices of different tissues, such as muscle, cartilage, and cornea. In skin, lumican is present as a glycoprotein. It plays a critical role in collagen fibrillogenesis, as shown by knocking out of its gene in mice. A direct link between lumican expression and melanoma progression and metastasis has been demonstrated. Lumican was shown to impede tumour cell migration and invasion by directly interacting with the α2β1 integrin. In addition, an active sequence of the lumican core protein, called lumcorin, was identified as being responsible for inhibition of melanoma cell migration. Lumican was also shown to exert angiostatic properties by downregulating the proteolytic activity associated with endothelial cell membranes, particularly matrix metalloproteinase (MMP)-14 and MMP-9. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 28966337503

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 68 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Diana Scharnus
Battle Creek, US
★★★★★ 4
Dogs love these!
Size: Small, Color: Pink
My miniature Goldendoodle puppies love these! The only drawback is after several weeks of chewing, the bones develop pretty sharp edges long before the actual bone has been worn down. At that point, they are dangerous for the dog’s gums and must be thrown away.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
P
Verified Purchase
princeton von d
Cuba, US
★★★★★ 5
🦴 Micro Bone, Major Relief; Perfect Puppy Teething Chew Toy
Size: X-Small, Color: Blue, Size: X-Small, Color: Blue
🐾 Hi, I’m PVD; teething survivor, nub enthusiast, and gum massage advocate. This tiny blue bone was my day-one favorite from 8 weeks to 5.5 months, it handled every chew session, tantrum, and tooth eruption with dignity. I’ve officially “aged out,” but I still salute it. ⭐ Why it earned 5 stars: ✔️ Perfect XS size for toy breed jaws ✔️ Soft on sore gums, durable enough for dramatic chewing ✔️ Ridges + nubs = mouth spa treatment ✔️ Chilling it = elite teething relief ✔️ Kept me busy and prevented chewing on illegal things (furniture, shoes… mother) 🌀 Why I’m now gracefully retiring it (but still recommending): ✘ Jaw strength and confidence grew but I didn’t vibe with the larger size versions (tried and rejected them with judgment) ✘ Texture now too gentle for my post-teething chew style ✘ Advanced chewers may get bored once the rage-chewing era passes ✘ I get gum relief via Nylabone Nubz edible chews now Best For: • XS-Small breed puppies, especially under 5 lbs • Teething stages + gum relief • Delicate chewers or fur babies still in the love-bite phase • First-time puppy parents (trust me, this bone prevents household drama!) • 8 weeks–6 months old 🚫 Not for adult teeth or advanced chew techniques. 📝 Final Re-Barks: Iconic starter bone for toy breed pups. Affordable, safe, and genuinely soothing during teething chaos. It carried me through the hardest months (and saved several legs; both human and furniture). I’ve outgrown it; but I’ll forever endorse it for the next generation of tiny chewers. — PVD (Tiny Tooth Graduate, Former Chew Therapy Success Story 🧊🦴)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 17, 2025
U
Verified Purchase
UMmba
Lowell, US
★★★★★ 3
Nylabone Puppy Treat Starter Pack - A Mixed Bag of Delight and Disappointment
Size: Small, Color: Blue
I recently purchased the Nylabone Puppy Treat Starter Pack for my adorable 5lb puppy, and overall, I have mixed feelings about this product. While I was initially satisfied with the variety pack, one of the bones in particular left me disappointed due to its lack of durability. Let's start with the positives. The Nylabone Puppy Treat Starter Pack comes with three different toys: a blue puppy teething toy, a nylon dog toy, and a chew treat. This variety is great for keeping my puppy engaged and entertained, especially during the teething phase. The blue puppy teething toy is specifically designed for soothing sore gums, and my puppy seemed to find great relief when chewing on it. It has a pleasant texture that is gentle on the teeth and gums, making it an ideal choice for teething puppies. The nylon dog toy included in the pack is durable and sturdy. It has a satisfyingly textured surface that provides an excellent chewing experience for my little furry friend. The toy is designed to withstand the strong chewing habits of puppies, and it has certainly proven to be long-lasting compared to other toys I've tried in the past. My puppy enjoys gnawing on it for extended periods without any signs of damage. Now, let's address the bone that failed to meet expectations. One of the bones included in the pack was devoured by my puppy within a single evening. I was taken aback by how quickly it was consumed, especially considering my puppy's small size. While the other bones in the pack held up well, this particular one lacked the durability I had hoped for. I understand that puppies have strong jaws, but I expected the bone to withstand more than a few hours of chewing. Despite this disappointment, I must mention that the bone did not cause any harm to my puppy. It is important to supervise your puppy while they chew on any toys, especially if they have a tendency to swallow large chunks. In this case, I was fortunate that my puppy did not experience any adverse effects after consuming the bone. However, it's crucial to exercise caution and ensure that your puppy doesn't ingest anything that could potentially be harmful. Overall, while the Nylabone Puppy Treat Starter Pack has its upsides, I cannot ignore the fact that one of the bones failed to meet expectations in terms of durability. However, the other toys included in the pack provided a satisfactory experience for my puppy, and they have proven to be long-lasting. I would recommend this product with the caveat that you closely monitor your puppy's chewing habits and potentially avoid the bone that didn't hold up well in my particular case.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2023
R
Verified Purchase
Rafael A
Louisville, US
★★★★★ 5
⭐⭐⭐⭐⭐ Great for teething puppies
Size: Small, Color: Pink
I purchased the Nylabone puppy chew toys for my teething puppy, and they’ve been a big help. The toys are the perfect size for a young puppy and feel durable without being too hard. My puppy enjoys chewing on them, and they’ve helped redirect chewing away from furniture and shoes. I also like that they’re designed specifically for puppies, so they’re gentle enough for growing teeth and gums. The variety in the set keeps my puppy interested, and the toys have held up well with daily use. They’re easy to clean and feel safe to give to a puppy. Overall, these are great chew toys for puppies. They’re effective, well made, and helpful during the teething stage. I would definitely recommend them to new puppy owners.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025
D
Verified Purchase
Debbie Hanchett
Whiting, US
★★★★★ 5
Happy puppy with this durable bone
Size: X-Small, Color: Pink
Our new puppy loves the texture and thickness of this bone. She is an aggressive chewed and has not yet destroyed this bone. We have purchased Nylabones for our dogs year after year and have had several happy puppies over the years.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026

recommand products