SKU: 28966337503

Human Lumican, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Lumican, His tagProduct Specification Species Human Synonyms Keratan sulfate proteoglycan lumican (KSPG lumican) Accession P51884 Amino Acid Sequence Protein sequence(P51884, Gln19 Asn338, with C 10*His)

Product Specification


Species Human
Synonyms Keratan sulfate proteoglycan lumican (KSPG lumican)
Accession P51884
Amino Acid Sequence

Protein sequence(P51884, Gln19-Asn338, with C-10*His)
QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLNGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 38.3kDa Actual: 46kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

Lumican is a member of the small leucine-rich proteoglycan family. It is present in numerous extracellular matrices of different tissues, such as muscle, cartilage, and cornea. In skin, lumican is present as a glycoprotein. It plays a critical role in collagen fibrillogenesis, as shown by knocking out of its gene in mice. A direct link between lumican expression and melanoma progression and metastasis has been demonstrated. Lumican was shown to impede tumour cell migration and invasion by directly interacting with the α2β1 integrin. In addition, an active sequence of the lumican core protein, called lumcorin, was identified as being responsible for inhibition of melanoma cell migration. Lumican was also shown to exert angiostatic properties by downregulating the proteolytic activity associated with endothelial cell membranes, particularly matrix metalloproteinase (MMP)-14 and MMP-9. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 28966337503

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
David monn
Grantham, US
★★★★★ 5
Well built
Color: Rustic Brown
Very nice shelving. We remodeled our bathroom and they fit perfect behind toilet
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
X
Verified Purchase
XXBrownXX
New York, US
★★★★★ 3
Damaged Product
Color: White
Item has some parts of the board being damaged. The quality of the wood is not good. Very disappointed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
V
Verified Purchase
Vanessa Rivera
Belleville, US
★★★★★ 5
Stylish and very functional for a primary bathroom
Color: C. Black, Color: C. Black
I installed these shelves in my primary bathroom and I’m very happy with the result. The design is clean and modern, and it helps keep the space organized without looking cluttered. I really like the combination of the solid shelf and the wire basket—it’s perfect for storing towels, toilet paper, and a few decorative items. The materials feel sturdy and well made, not cheap or flimsy. Installation was straightforward and didn’t require anything complicated. It definitely upgraded the look of my bathroom and made better use of the vertical space. Great option for a primary bathroom if you want both function and style. I would recommend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 22, 2026
Y
Verified Purchase
Yaima Blanco
Massapequa, US
★★★★★ 5
Sleek and Minimalist Bathroom Shelf
Color: A. Brown, Color: A. Brown
I recently got this bathroom shelf, and I love it! The minimalist design looks super clean and modern, and it fits perfectly in my bathroom without taking up too much space. The build quality is great—it feels sturdy and well-made, and it holds my toiletries easily. Installation was simple, and it really helps keep things organized. Overall, it’s a stylish, practical addition to any bathroom. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026
K
Verified Purchase
🦋 •: KREATING KRISTIN :• 🦋
New York, US
★★★★★ 5
Perfect Rustic Touch for Our Bathroom Makeover!
Color: A. Brown, Color: A. Brown
We were redoing our bathroom and wanted a more rustic, farmhouse vibe and this shelf set absolutely delivered! As soon as I saw it, I fell in love with the design. The color (we chose Rustic Brown) is warm and charming, and it instantly made our bathroom feel cozier and more put-together. Installation was super easy! The shelves are sturdy and well-made, with invisible brackets that give a clean, floating look. I especially love the metal basket; it holds several rolls of toilet paper and still looks decorative. The included sign is a cute bonus and adds a nice finishing touch. The depth of the shelves is perfect for holding toiletries or small decorations without sticking out too far. It really maximized the space over our toilet and helped us stay organized without sacrificing style. Overall, this set exceeded our expectations. It looks amazing, feels durable, and totally transformed our space. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 21, 2025

recommand products