SKU: 29921924456

Human IL-6, His tag

Sale price$128.25 Regular price$142.50
Save 10%

Pay in installments of $35.62 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-6, His tagProduct Specification Species Human Synonyms B cell stimulatory factor 2 (BSF 2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta 2 (IFN beta 2) Accession P05231 Amino Acid Sequence Protein sequence(P05231, Val30 Met212, with C 10*His)

Product Specification


Species Human
Synonyms B-cell stimulatory factor 2 (BSF-2), CTL differentiation factor (CDF), Hybridoma growth factor, Interferon beta-2 (IFN-beta-2)
Accession P05231
Amino Acid Sequence

Protein sequence(P05231, Val30-Met212, with C-10*His)
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQMGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 22.4kDa Actual: 22-23kDa

Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

Interleukin 6 (IL-6) is a prototypical cytokine for maintaining homeostasis. When homeostasis is disrupted by infections or tissue injuries, IL-6 is produced immediately and contributes to host defense against such emergent stress through activation of acute-phase and immune responses. However, dysregulated excessive and persistent synthesis of IL-6 has a pathological effect on, respectively, acute systemic inflammatory response syndrome and chronic immune-mediated diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29921924456

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
S
Verified Purchase
Stacie☺
Cuba, US
★★★★★ 5
Fun solid ball
Style: Recharges, Size: Medium, Style: Recharges, Size: Medium
Great squeaky balls! Glow doesn’t last for a long time, but they go far in the Chuck it. Solid ball, my dog doesn’t seem to destroy them.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026
J
Verified Purchase
Jennifer Gugala
Birmingham, US
★★★★★ 5
Great ball!
Style: Recharges, Size: Medium
The dog loves chasing it! Walks around sqeeking it all the time. And bonus, I can see it in the middle of the floor when I get up in the middle of the night so I won't unknowing step on it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026
F
Verified Purchase
Fearless
Dallas, US
★★★★★ 5
Lil boy's favorite ball
Style: Recharges, Size: Medium
The squeak gets my little boy every time. The glow factor is under par. I mainly get it because he also enjoys the brighter colors. All of the others be trying to get his ball. Good product just wish it would glow better because our park times are right around sunset.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 20, 2026
S
Verified Purchase
S. Ridgel
Los Angeles, US
★★★★★ 5
Chuck it!
Style: Recharges, Size: Medium
My Golden Doodle absolutely loves this ball. His new favorite!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
D
Verified Purchase
Debbie
San Leandro, US
★★★★★ 4
The glow doesn’t last long, not super bright.
Style: Recharges, Size: Medium
I charge my glow in the dark balls with a black light flashlight, this one was not very bright, and it did not hold the charge very long. Also, with it being green, it was hard for my dog to find in the grass.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026

recommand products