CCoV N protein , His tag
SKU: 3002578329

CCoV N protein , His tag

Sale price$40.50 Regular price$45.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CCoV N protein , His tagProduct Specification Synonyms 5' nucleotidase (5' NT), Acid phosphatase 3, Ecto 5' nucleotidase, Protein tyrosine phosphatase ACP3, Thiamine monophosphatase (TMPase), ACP3, ACPP Accession Q7T6S8 Amino Acid Sequence Protein sequence(Q7T6S8, Met1 Asn382, with C 10*His)

Product Specification


Synonyms 5'-nucleotidase (5'-NT), Acid phosphatase 3, Ecto-5'-nucleotidase, Protein tyrosine phosphatase ACP3, Thiamine monophosphatase (TMPase), ACP3, ACPP
Accession Q7T6S8
Amino Acid Sequence

Protein sequence(Q7T6S8, Met1-Asn382, with C-10*His)
MASQGQRVSWGDESTKRRGRSNSRGRKNNDIPLSFFNPVTLKQGSKFWDLCPRDFVPLKIGNKDQQIGYWNRQIRYRMVKGQRKDLPERWFFYYLGTGPHADAKFKQKLDGVVWVAKEGAMTKPTTLGTRGTNNESKALKFDVKVPSEFQLEVNQSRDNSRSRSQSRSQSRTRAQSRGRQQSNNKKDDSVEQAVLAALKKLGVDTEKQQQRARSKSKERSNSKTRDTTPKNENKHTWKRTAGKGDVTKFYGARSSSANFGDSDLVANGNSAKHYPQLAECVPSVSSILFGSHWTAKEDGDQIEVTFTHKYHLPKDDPKTGQFLQQINAYARPSEVAKEQRLRKARSKSAERVEQEVVPDALTENYTDVFDDTQVEIIDEVTNGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 45.1kDa Actual: 50kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

· 12 months from date of receipt, -20 to -70 °C as supplied. 
· 6 months, -20 to -70 °C under sterile conditions after reconstitution.
· 1 week, 2 to 8 °C under sterile conditions after reconstitution.  
· Please avoid repeated freeze-thaw cycles.

Background

The nucleocapsid (N) protein is a protein that packages the positive-sense RNA genome of coronaviruses to form ribonucleoprotein structures enclosed within the viral capsid. The N protein is the most highly expressed of the four major coronavirus structural proteins. In addition to its interactions with RNA, N forms protein-protein interactions with the coronavirus membrane protein (M) during the process of viral assembly. N also has additional functions in manipulating the cell cycle of the host cell.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3002578329

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 1373 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
H
Verified Purchase
Helen
Pawtucket, US
★★★★★ 5
Fast
Excellent and easy transaction
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
C
Verified Purchase
Christin
Omaha, US
★★★★★ 5
Always there
Very simple claim process. Reliable coverage that's worth the cost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026
J
Verified Purchase
Jan
Omaha, US
★★★★★ 5
Definitely Worth It
Quick and easy process. Coffee maker died and I had the insurance. Refunded and only ended up paying the price of insurance. Would do it again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2026
C
Verified Purchase
Chris
Port Orchard, US
★★★★★ 5
Claim was easy, speedy, and Amazon gift card was applied almost immediately.
I had to make a claim for a Ninja blender that was emitting an odor of burning or melting wires. I called a service representative thinking I might encounter a problem and was surprised. The agent was helpful and made the entire process so easy I applaud her! The Amazon gift card was posted to my account almost immediately after UPS picked the product up. I have decided that for products with a large number of parts and electronics that can fail I will purchase Asurion protection.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
S
Verified Purchase
Sharon A. Hall
Pawtucket, US
★★★★★ 1
Asurion "Assures" nothing!
Asurion has terrible Customer Support. All machine based. They give you no phone # for human interaction. Their online Support process is very close-ended. It is a checklist designed to frustrate purchasers whose issue lies outside only the very issue. My issue: I bought "Cuisinart TOB-40FR Custom Classic Toaster Oven Broiler, Silver (Renewed)" on May 26, 2024. It stated it had a 90 day warranty. So I bought an Asurion Protection Plan also to cover it for 3 years. The toaster started flaking off metal finish inside the oven over the cooking area. I tried to file a claim with Asurion and they told me the Manufacturers warranty was still in effect and I should contact Cuisinart. This despite the oven was sold with a Amazon Renewed verbiage stating a 90 day warranty. And they have nothing on their "Machine Checklist" to cover this eventuality. And I would assume I am not the only one who takes the "Renewed" route and backs it up with a "Protection Plan". They will frustrate you no end. I suspect, like many insurances, they seek to deny, deny, deny, in hopes the purchaser will give up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026

recommand products