SKU: 31860862790

ALK-1/ACVRL1 Fc Chimera Protein, Human

Sale price$266.40 Regular price$296.00
Save 10%

Pay in installments of $74.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ALK-1/ACVRL1 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms Activin receptor like kinase 1 (ALK 1), ACVRL1, ACVRLK1, ALK1 Accession P37023 Amino Acid Sequence Asp22 Gln118, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms Activin receptor-like kinase 1 (ALK-1), ACVRL1, ACVRLK1, ALK1
Accession P37023
Amino Acid Sequence

Asp22-Gln118, with C-terminal Human IgG1 Fc DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 45-52kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Cindy Lora Gil. Bruno Larrivée. Alk1 haploinsufficiency causes glomerular dysfunction and microalbuminuria in diabetic mice. Scientific RepoRtS (2020) 10.

Background

The Bone Morphogenetic Protein (BMP) receptor activin receptor–like kinase 1 (Alk1), which is predominantly expressed in the vascular endothelium, has been shown to play a critical role in angiogenesis. Embryos lacking Alk1 die early during embryonic development due to impaired vascular remodeling and lack of perivascular cell coverage. In renal physiology, Alk1 has been suggested to play an important role in the regulation of extracellular matrix deposition, including collagen type I and fibronectin, and Alk1 heterozygosity has been associated with increased renal fibrosis in a mouse model of obstructive nephropathy, probably due to the decrease in the Alk1/Smad1 antifibrotic/protective signaling in renal fibroblasts.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 31860862790

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Becca
Draper, US
★★★★★ 5
It was worth every cent
Color: Cool Grey, Size: 24x24x12 inch
I have BPPV. It's a condition where tiny ear crystals come out of place and move within your ear canals - this fools your brain into thinking you're in motion, causing severe dizziness. The most common treatment is the Epley Maneuver, and that actually helps a lot. However, I was going through a period where every single day I'd wake up with severe dizziness. Even if I managed to do the Epley Maneuver and it worked, the entire rest of the day would be ruined because I'd still feel generally unwell and nauseous. I ended up getting a book about BPPV and the author strongly recommended sleeping at at least a 30 degree angle. So, that's why I ended up buying this wedge pillow... I started using it April 26 and today is May 17. Since I began using it as a pillow, I have not woke up dizzy again. That is so huge! It may be that sleeping at a 30 degree angle deserves 5 Stars but thought I'd give this pillow 5 Stars too, as it's been a great experience. If you suffer from this, here's how the angle should be...If you lay your head on a pillow and open your eyes, you should not be looking at the ceiling. With the right angle, you should be looking at where the wall meets the ceiling. If so, you know you're at the right angle. As far as pillow itself, I'd say the pillow case fabric is of average quality. Not really remarkable in any way. It seems decent. Good value for the price. The inside is firm (which is just what I needed) but comfortable, and I tend to not move around much the entire night. I like this very much and if it does start wearing out, I'll definitely come back here and buy another. Would recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2023
A
Verified Purchase
Amazon Customer
Boise, US
★★★★★ 4
A bit too firm but great otherwise
Color: Cool Grey, Size: 24x24x12 inch
I got this wedge pillow primarily to have something to lean my head against (I like to lay on my side when reading or looking at my phone at night sometimes), or to sit upright when reading in bed. It's very comfortable doing both now. It does a really good job at being a nice support for the back of my bed. Only negative is I feel it's too firm. I wouldn't use it as a primary pillow, but it's definitely good for back support at least. While I won't mark it down for this, I do find it very large. If you have anything smaller then a queen it may take up more of your bed then you'd like. Definitely recommend. Hopefully will last quite a long while as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2025
H
Verified Purchase
HBDMom
Port Orchard, US
★★★★★ 5
So helpful after surgery.
Color: Solid Warm Gray, Size: 24x24x12 inch
Perfect support while recording from abdominal surgery. This pillow maintains its shape and is not overly soft. I used it vertically as a prop for watching television and then used it horizontally to prop myself up to sleep, once I returned to sleeping in bed. I used this daily for 6 weeks or so following surgery. The cover can be removed and machine washed. The non-slip nubbies are helpful. This pilllow is high quality and really helped to minimize pain and improve my sleep after surgery.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2026
A
Verified Purchase
Amazon Customer
West Palm Beach, US
★★★★★ 3
Nice wedge pillow but not enough...
Color: Cool Grey, Size: 24x24x12 inch
It came compacted and when I opened it expanded almost immediately, maybe took like 20 minutes to fully decompress. Its soft and comfortable and the cover is really nice. But it does have a strong chemical smell, which is normal for this kind of brand new memory foam, I just put it on a table with a window open near it and after maybe 24 hours the smell was almost completely gone. The problem is that I bought this to have a elevated position when sleeping but the 30° are just not enough for me. I wish it was at least 45° but I could not find any pillow with that amount of degree... it's either 30° or like 75° in the other position. At the base of the pillow there is a little ridge that is comfortable for the lower back but makes me slide down in the middle of the night so I end up almost laying flat with my neck on the base ridge. With my slim build my lumbar area gets some nice support but makes my head almost have a "fall backwards" sensation, I like having my neck have a "push-forward" position with my pillow, but when adding another pillow to try and get to a comfortable position it only makes me slide down even more... :/
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 6, 2024
C
Verified Purchase
C.H. Aiken
Draper, US
★★★★★ 5
Very firm and durable
Color: Cool Grey, Size: 24x24x12 inch
worked great for husbands surgery recovery. Very affordable, firmness was great, looked nice on the bed and also used it for the grandkids when they were watching a movie. Moved around with ease. Didn't use it to sleep with all night though. He could only make it half the night but that wasn't the pillows fault. It was the cast on his arm. Definitely did its purpose after surgery and the need to sit up in bed more. highly recommend
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026

recommand products