SKU: 79367849

S100B Protein, Human

Sale price$178.20 Regular price$198.00
Save 10%

Pay in installments of $49.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 31 - Sep 5

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

S100B Protein, HumanProduct Specification Species Human Accession P04271 Amino Acid Sequence Ser2 Glu92, with N terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE Expression System E. coli Molecular Weight 11 12 kDa(Reducing) Purity 95% by SDS PAGE Endotoxin <2EU g Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution Reconstitute at less than 1

Product Specification


Species Human
Accession P04271
Amino Acid Sequence

Ser2-Glu92, with N-terminal 8*His MHHHHHHHHSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Expression System E.coli
Molecular Weight

11-12 kDa(Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

S100B is a small calcium-binding protein in the neuronal system, and belongs to the S100 family. S100B proteins are a family of 25 homologous intracellular calcium-binding proteins characterized by EF hand motifs, low molecular weights (9–13 kDa), ability to form homodimers, heterodimers and oligomeric assemblies, and are characterized by tissue and cell-specific expression.  They are solely present in vertebrates. S100B protein is mainly expressed in the neuronal system such as astrocytes, maturing oligodendrocytes, dendritic cells, and Schwann cells. However, some other cells outside the brain, like kidney epithelial cells, ependymocytes, chondrocytes, adipocytes, and melanocytes, can also express S100B protein.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 79367849

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
justin
New York, US
★★★★★ 5
Insightful
Format: Paperback
This book has been an absolute game-changer for anyone navigating the world of midterm rentals and seeking actionable insights to succeed. Unlike many other real estate books, it is refreshingly devoid of unnecessary fluff and gets straight to the point, offering invaluable advice that can be put into practice right away. Erin's expertise shines through in every page of this guide. Her approach is practical, well-organized, and laser-focused on helping hosts make the most of their 30+ day stays. What sets this guide apart is its emphasis on actionable insights. It's not just about theory; it's about real-world strategies that can be implemented immediately. Erin doesn't just tell you what to do, she explains why it works and how to adapt it to your unique situation. One of the things I appreciated most was the structure of the guide. Divided into four parts, it covers every essential aspect of midterm rentals, from property preparation and pricing strategies to guest communication and handling potential challenges. The step-by-step breakdown of each part makes it easy to follow along, whether you're a seasoned host looking to refine your approach or a newcomer eager to dive into the world of midterm rentals. Erin's Guide to Midterm Rentals doesn't overwhelm with jargon or complicated concepts. Instead, it provides clear and concise explanations, making it accessible to readers with varying levels of experience. The practical examples and case studies sprinkled throughout the guide add a real-world dimension, helping readers envision how the strategies can be applied to their own situations. In a market flooded with real estate resources, Erin's Guide to Midterm Rentals stands out as a beacon of practicality and usefulness. It's evident that the author genuinely cares about her readers' success and has taken the time to distill her own experiences and insights into a guide that is both informative and inspiring.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 22, 2023
C
Verified Purchase
Carolyn Farmer
Belleville, US
★★★★★ 5
Game changer
Format: Paperback
I never write reviews and this will be short. This book is a game changer for me. Erin presents an organized knowledgeable review of Midterm rentals with lots of legal advise, check lists, and common sense. This information has taken the scary out of starting a business using my basement. My book is well worn from reading it so many times. Have ordered her second book and will wear it out also. Thanks you Erin
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 21, 2025
J
Verified Purchase
Jahmal Bethel
San Leandro, US
★★★★★ 5
Loved this book !!!
Format: Paperback, Format: Paperback
Great information!!! Erin answered alot of questions I had about MTR. I was able to implement some things she had recommended in her book. No joke, I got my first tenant the following weekend. I still have some questions about minor things but vía her you tube channel I know I will find the answer. One more thing, she will send you a copy of the lease she uses and the welcome letter she provides her tenant if you send her a picture of the book to her email. That helped a lot! I recommend this book. Go get your copy. Worth it!!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2023
J
Verified Purchase
JDHOLDER
Los Angeles, US
★★★★★ 5
As expected
Format: Kindle
This is a great book to get started. Its an easy read with some relevant resources. If you are thinking of renting midterm and have little experience I would suggest this book.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 18, 2025
L
LyfeCoach
New York, US
★★★★★ 4
Easy to read Guide
Format: Kindle, Format: Kindle
I really enjoyed Erin's podcast on YouTube and wanted to be able to look up the information she was sharing. The book had large enough print for easy ready, clear chapters and direct points. Looking forward to using it as a reference.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2023

recommand products