SKU: 32353965755

Human FDX1 Protein, His Tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human FDX1 Protein, His TagProduct Specification Species Human Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin 1, Hepatoredoxin, ADX Accession P10109 Amino Acid Sequence Protein sequence (P10109, Ser61 Ser184, with C His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Expression System E. coli Molecular Weight Predicted MW: 15. 4 kDa Observed MW: 13 kDa Purity 90% by SDS PAGE

Product Specification


Species Human
Synonyms Adrenodoxin, mitochondrial, Adrenal ferredoxin, Ferredoxin-1, Hepatoredoxin, ADX
Accession P10109
Amino Acid Sequence

Protein sequence (P10109, Ser61-Ser184, with C-His Tag) SSSEDKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

Expression System E.coli
Molecular Weight Predicted MW: 15.4 kDa Observed MW: 13 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

FDX1, or ferredoxin 1, is an essential mitochondrial iron-sulfur protein that functions as a critical electron carrier in several fundamental biochemical pathways. Primarily located in the mitochondrial matrix, it shuttles electrons from NADPH via ferredoxin reductase to key enzymes involved in steroidogenesis, heme biosynthesis, and iron-sulfur cluster biogenesis. By facilitating these electron transfer reactions, FDX1 plays a central role in cellular metabolism, energy production, and the synthesis of vital biomolecules. Recent research has also highlighted its significant role in regulating copper-dependent cell death (cuproptosis), making it a protein of growing interest in cancer biology and therapeutic development.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 32353965755

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Brandon
Fort Morgan, US
★★★★★ 5
Great Tray For Storing My Everyday Carries
Size: 8.5" x 5.8" x 1.9", Color: Black
My everyday carry items (wallet, keys, etc.), used to just get thrown around wherever when I'd get home, but this little tray makes a great, defined, space for me to keep those things when I don't need them on me. The soft lining reduces the obnoxious sound of throwing keys on a hard surface, and of course keeps me from scratching up a surface. The build feels quality and I haven't seen any damage to it yet. Also the all black version with gold buckle looks quite good and adds a subtle touch of luxury. Absolute recommend for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 15, 2026
D
Verified Purchase
David Jordan
Chelsea, US
★★★★★ 5
Just the right size to empty your pockets.
Size: 8.5" x 5.8" x 1.9", Color: Orange
Perfect size to empty my pockets when I get home. Fits my wallet, keys, AirPods, etc. excellent quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 21, 2026
P
Verified Purchase
Pilot Wife
Fort Morgan, US
★★★★★ 5
Nice and classy
Size: 8.5" x 5.8" x 1.9", Color: Black
Bought this for my husband for Christmas and he loved it. Super classy elegant well made box. Perfect for bedside nightstand for your watch and rings.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2025
S
Verified Purchase
SC
Whiting, US
★★★★★ 5
Nice looking and durable
Size: 8.5" x 5.8" x 1.9", Color: Black
I bought this for my little nephew to put his rocks in and out and to keep them in. It’s perfect and durable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
A
Verified Purchase
Amazon Customer
Cuba, US
★★★★★ 5
Perfect size
Size: 8.5" x 5.8" x 1.9", Color: Black, Size: 8.5" x 5.8" x 1.9", Color: Black
Love the look of leather and metal together.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026

recommand products