SKU: 33572648505

Human Doublecortin, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Doublecortin, His tagProduct Specification Species Human Synonyms Doublin, Lissencephalin X (Lis X), DCX, DBCN, LISX Accession O43602 Amino Acid Sequence Protein sequence (O43602, Asn269 Ser360, with C 10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 11. 4 kDa Observed MW: 16 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical

Product Specification


Species Human
Synonyms Doublin, Lissencephalin-X (Lis-X), DCX, DBCN, LISX
Accession O43602
Amino Acid Sequence

Protein sequence (O43602, Asn269-Ser360, with C-10*His) NECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 11.4 kDa Observed MW: 16 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Doublecortin (DCX) is a microtubule-associated protein expressed by neuronal precursor cells and immature neurons in embryonic and adult cortical structures. In vivo and in vitro assays show that Doublecortin stabilizes microtubules and causes bundling. Doublecortin is a basic protein with an iso-electric point of 10 typical of microtubule-binding proteins. Doublecortin is mutated in X-linked lissencephaly and the double cortex syndrome, and the clinical manifestations are sex-linked. In males, X-linked lissencephaly produces a smooth brain due to lack of migration of immature neurons, which normally promote folding of the brain surface. Double cortex syndrome is characterized by abnormal migration of neural tissue during development which results in two bands of misplaced neurons within the subcortical white, generating two cortices, giving the name to the syndrome; this finding generally occurs in females. At least 49 disease-causing mutations in this gene have been discovered.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33572648505

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nathaniel Bornstein
West Palm Beach, US
★★★★★ 5
Endless Fun and Excitement: Outward Hound Squeaker Ballz Fetch Dog Toy Review
Color: Multi Squeaker Balls, Size: Medium, Style: 4-Pack
f you're searching for the ultimate entertainment solution for your furry friend, look no further than the Outward Hound Squeaker Ballz Fetch Dog Toy. As a proud dog owner, I can attest to the sheer joy and excitement that these toys bring to our canine companions. Here's why the Outward Hound Squeaker Ballz Fetch Dog Toy deserves all the praise: Irresistible Squeaky Fun: The Outward Hound Squeaker Ballz are an absolute delight for dogs of all shapes and sizes. Each ball features an attention-grabbing squeaker that ignites your pup's natural instincts for play and exploration. The squeaky sound adds an extra layer of excitement to fetch games, encouraging hours of active and engaging playtime. Durable Construction: Made from high-quality, durable materials, the Outward Hound Squeaker Ballz are built to withstand the rigors of enthusiastic play. Whether your dog loves to chase, fetch, or chew, these toys hold up remarkably well against rough handling and gnawing, ensuring long-lasting enjoyment and entertainment for your furry friend. Versatile Play Options: With a convenient pack of four medium-sized balls, the Outward Hound Squeaker Ballz offer endless opportunities for interactive play and bonding with your dog. Whether you're playing indoors or outdoors, these versatile toys provide a fun and engaging outlet for your dog's energy, helping to promote physical activity and mental stimulation. Bright and Colorful Design: The vibrant colors and eye-catching design of the Outward Hound Squeaker Ballz make them easy to spot and retrieve during outdoor play sessions. Their bright hues add an element of excitement to fetch games, keeping your dog entertained and focused on the task at hand. Safe and Non-Toxic: As responsible pet owners, we prioritize the safety and well-being of our furry companions. The Outward Hound Squeaker Ballz are crafted from pet-safe materials that are free from harmful chemicals and toxins, providing peace of mind knowing that your dog is playing with a safe and non-toxic toy. Affordable and Value-Packed: With four balls included in each pack, the Outward Hound Squeaker Ballz offer exceptional value for the price. You can keep multiple balls on hand for backup or share them with fellow dog owners, spreading the joy and excitement of playtime to canine friends everywhere. In conclusion, the Outward Hound Squeaker Ballz Fetch Dog Toy is a must-have addition to any dog owner's collection of pet supplies. With their irresistible squeaky fun, durable construction, versatile play options, bright and colorful design, safety features, and unbeatable value, these toys bring endless joy and entertainment to dogs of all ages and breeds. Treat your furry friend to the ultimate playtime experience with Outward Hound Squeaker Ballz Fetch Dog Toy - you won't be disappointed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 27, 2024
A
Verified Purchase
Amazon Customer
Port Orchard, US
★★★★★ 5
Squeaky fun!!
Color: Multi-colored, Size: Small - 12 Pack
These are perfect they fit in my hyper pet shooter and they squeak too! My dogs absolutely love themZ. Seems to be good value and I think they will soften up over time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 28, 2026
J
Verified Purchase
JC
Draper, US
★★★★★ 5
Small and squeaky!
Pretty perfect! Great size for small dog and they do squeak. It’s helpful to use both hands when getting the ball to squeak. It’s a bit difficult with just one hand, but that can’t be avoided because the size of the tennis ball is small. We use these inside and outside to exercise our puppy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 13, 2025
F
Verified Purchase
Frannie Long
Boise, US
★★★★★ 5
Milo approved!!!
Color: Multi-colored, Size: Large - 4 Pack
My dog, Milo, loves these squeeky balls. He is a larger dog but not huge. He's about 60 lbs. They are the perfect fit to his mouth. Soft enough for him to chew on but sturdy enough to hold up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 30, 2026
C
Verified Purchase
CVF
Lexington, US
★★★★★ 5
Squeaky Tennis Balls Are Great Fun!
Color: Multi-colored, Size: Large - 4 Pack
My Doberman loves these! That said, she doe's tear them up over time because once she gets one, she squeak's it continually and chews it. They are tennis ball which are not made to withstand aggressive chewers, but she loves them. They are a great size for her, we play with them every night. She's not a picker and doesn't swallow things so I let her have each one until it's destroyed. Then we get out another one to start the process again. They are a reasonable price for the fun she has.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 31, 2026

recommand products