SKU: 3501838558

FABP3 His Tag Protein, Human

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 26 - Aug 31

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FABP3 His Tag Protein, HumanProduct Specification Species Human Accession P05413 Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA Expression System E. coli Molecular Weight 15. 7 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Human
Accession P05413
Amino Acid Sequence MHHHHHHVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Expression System E.coli
Molecular Weight 15.7 kDa(Reducing)
Purity

95%,  by SDS-PAGE under reducing conditions

Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Fatty acid-binding protein 3 (FABP3) is a cytosolic protein found in various tissues, including heart, skeletal muscle, intestinal mucosa, liver, and kidney. It is also highly expressed in the adult brain, particularly in the pons, frontal lobe, and hippocampus. In the brain, FABP3 regulates the lipid composition of the membrane and transports fatty acids between different intracellular compartments. It is released extracellularly after neuronal damage and high cerebrospinal fluid (CSF) concentration of FABP3 is found in acute conditions, such as brain injury and stroke. CSF FABP3 concentration is also higher in conditions with neuro degeneration/neuronal damage, e.g., Alzheimer’s disease (AD), mild cognitive impairment (MCI) due to AD, dementia with Lewy bodies, and Creutzfeldt–Jakob disease. CSF FABP3 concentration correlates with cognitive decline and are associated with brain volume loss in areas selectively affected in early AD. Thus, FABP3 is suggested to be a general marker of neuronal damage.

 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 3501838558

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
GracieMarie
Grantham, US
★★★★★ 5
A Toy Ball for All Seasons!
Style: Small Ball, Size: 1 Count, Style: Small Ball, Size: 1 Count
Oh my gosh! I’m so happy to find the almost exact ball my 5 1/2 pound 9 month old Morkie, Charlie, that mommy lost at the campgrounds! It was his favorite toy and although he has others, he loved this one above all others, so to find another one was an answer to my prayers. The difference is so minor and in a good way. It is very durable as Charlie has very sharp teeth, but this one is just a bit softer making it easier to hang on to playing fetch. But for Charlie, the size is the same, the squeekiness is the same, the color is the same (yes they can see some colors) and he went into a jumping frenzy when I took it out of the package and the price was unbelievably inexpensive for such a high quality toy! Thank you! Thank you! Thank you! Good mommy! ( I’m ordering another one as a back up, jic!)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
G
Verified Purchase
GNosk
Carnegie, US
★★★★★ 5
Great investment.
Style: Small Ball, Size: 2 Count
Dogs love them. Durable. Chew worthy for a beagle and a German shepherd. You cannot smell the flavor imparted but the pups definitely can. Always purchase the amount you need so each dog can have one. .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
H
Verified Purchase
howdy
Grantham, US
★★★★★ 5
Bacon and a Ball? Can life get any better?
Style: Small Ball, Size: 3 Count
Come on.. these balls are the best. They smell like bacon, yes, they really do. They are durable and squeak. Upon aggressive play, the squeak will die out but the ball will still be useable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
S
Verified Purchase
shaa255
Lake Worth, US
★★★★★ 5
She LOVES this ball
Style: Small Ball, Size: 1 Count
Our dog likes toys, but this ball is now her favorite ball. She even took it to bed with her last night. Our dog is 65 pounds, but she likes smaller toys so I ordered the small ball. It’s a good size. It’s nice and soft and squeaks. She seems to kills the squeaker right away, but she didn’t with this ball. It seems to be the least amount of money I’ve spent on a toy for her and it’s her favorite. I ordered another one just to have on hand. This toy is a great bargain!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
M
Verified Purchase
Marvin
Boise, US
★★★★★ 4
Not Durable Enough for a Dachshund to be Left Alone With (Updated)
Style: Small Ball, Size: 3 Count
I just received these balls today and got one out for my daughter's Dachshund. She loved it for about 15 minutes and then gnawed a huge chunk out of it. It was in the garbage within 20 minutes of receiving it. I'm not even going to give her the other ones. We had an issue once before where she was chewing on her Kong and swallowed some pieces. It messed up her digestion for quite a while. Not taking the chance with these balls. Too bad because they have nice bounce and good squeak. She was thrilled with it until we saw that she ruined it and we quickly took it away from her. If you have a Dachshund or other aggressive chewer, I'd look for something else. UPDATE - I've bumped up the rating by 2 stars, changed the review title, and ordered another set. We found that we can't leave the dog alone with the ball, but if we use it to play with her, we can monitor when she starts to aggressively gnaw at it. So now, it's more of a fetch ball and we've taught her how to stop gnawing it and drop it for another chase. They still give in to her sharp little teeth more easily than other toys, but she really loves them and gets so excited when we get one out. It's easily her favorite toy, and who doesn't want to see their pup happy?! It's definitely not a chew toy, but it's been great as a fetch ball. If you go into it with that understanding, you and your pup will both be happier with the product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 23, 2024

recommand products