SKU: 36480881862

Human CCL20 Protein, hFc tag

Sale price$189.00 Regular price$210.00
Save 10%

Pay in installments of $52.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CCL20 Protein, hFc tagProduct Specification Species Human Synonyms C C motif chemokine 2, Beta chemokine exodus 1, CC chemokine LARC, Liver and activation regulated chemokine, Macrophage inflammatory protein 3 alpha (MIP 3 alpha), Small inducible cytokine A20, LARC, MIP3A, SCYA20 Accession P78556 Amino Acid Sequence Protein sequence (P78556, Ala27 Met96, with N hFc tag) ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM Expression System HEK293

Product Specification


Species Human
Synonyms C-C motif chemokine 2, Beta-chemokine exodus-1, CC chemokine LARC, Liver and activation-regulated chemokine, Macrophage inflammatory protein 3 alpha (MIP-3-alpha), Small-inducible cytokine A20, LARC, MIP3A, SCYA20
Accession P78556
Amino Acid Sequence

Protein sequence (P78556, Ala27-Met96, with N-hFc tag) ASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Expression System HEK293
Molecular Weight

Predicted MW: 35 kDa Observed MW: 35 kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-hFc tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CCL20, also known as macrophage inflammatory protein 3-alpha (MIP-3α), is a small cytokine belonging to the CC chemokine family. It plays a crucial role in the immune system. CCL20 is mainly produced by activated macrophages, dendritic cells, and epithelial cells in response to various stimuli such as inflammatory cytokines and microbial products. This protein exerts its function by binding to its specific receptor CCR6. The CCL20-CCR6 axis is involved in the recruitment of immune cells to the sites of inflammation, thereby contributing to both innate and adaptive immune responses. Dysregulation of CCL20 has been associated with several diseases, including autoimmune disorders and certain types of cancers, making it a potential therapeutic target for drug development.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36480881862

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Blusher
Louisville, US
★★★★★ 3
Right fit
I love this shirt it was nice and bright when I got it after a few wash it started to fade out a bit was a perfect fit for a medium built person 5’7 I still would recommend this product they are really nice and thick
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 14, 2025
J
Verified Purchase
John E. Holiday
Grantham, US
★★★★★ 5
Quality shirt. Not too blousy.
I'm 5'11" and hover around 175-180 lbs. so I'm a pretty average guy. I've been thin my whole life but now I'm in my 40's so if I don't watch it, my stomach will get bigger. I bought this shirt in slim-fit first. It was perfect but since these shirts are 100% cotton, I was concerned that after a couple washings, it would be too small (especially in the stomach area). I returned the slim-fit and bought this regular-fit (medium). For this review, I thought it would be helpful to compare the Amazon Essentials shirt to The Gap's regular oxford shirt. I've always liked the fit of Gap oxford shirts. Upon inspection, the weight and feel of the Amazon oxford cloth is exactly the same at the Gap's. I laid one of my old Gap shirts on top of this Amazon Essentials oxford. You can see from the pictures that the torso cut is exactly the same (about 21 inches pit-to-pit seam). I like that. I'm not a fat guy and I don't want a blousy shirt. This is neither too blousy nor too slim. Just right. The sleeves are perhaps 1/2 inch longer than the Gap shirt. Perhaps one negative is the tail. The Amazon Essentials tail is 1.5-2" longer than the Gap shirt. This makes the Amazon Essentials shirt a touch long for wearing untucked in my opinion. However, if you do tuck, a longer shirt stays tucked-in. So it depends how you want to wear it. I have a lady who does alterations. She'll charge $10 to shorten the tail if I wanted that. If I do have the Amazon shirt altered, it would still be a bargain. These are good quality shirts with a nice cut to them. I won't hesitate to buy them again. Highly recommended.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2020
T
Verified Purchase
Tracy J
Phoenix, US
★★★★★ 4
Decent quality. Sizing is normal but a bit generous in the midsection
Fit Type: Regular Fit, Color: White, Size: Large
I was impressed. Shirt is of fairly decent quality- thick cotton. My husband is normally a large. Given the sizing chart we almost ordered a medium, but it was good we bought a large. The sleeves are perfect but afraid it may shrink in the dryer. I think the reason people say loose fit is because it is boxy (square). Fine under a suit and we needed it urgently.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2026
V
Verified Purchase
veronica diaz
Natrona Heights, US
★★★★★ 5
With this shirt I say I do
Color: Khaki, Size: Small, Color: Khaki, Size: Small
This shirt definitely compliments the suit my son bought. Very light ,very comfortable,not quite tight fit ,but I can say that it fits perfectly .It matches well with a few colors ,purple being one of them . For having a teenager that at times mistreats his clothes ,and just throws the clothes on the hanger really any way . Not many wrinkles was really on it and I really had to fight whatever that was in his closet just to take this out and it was hanged up . For having it for more than a month I say not bad . It is worth it. And if it was me I wouldn't have any wrinkles on it what's so ever. Very delicate and easy to move in it. My son wore it to his friend's graduation party not one wrinkle on it afterwards. Very casual look. I will buy more for him
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 1, 2025
S
Verified Purchase
Steve
West Palm Beach, US
★★★★★ 5
Good value
Color: White Spots Black, Size: Large
Fit well and seem to be good quality
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 16, 2026

recommand products