SKU: 36668962063

EphA6 His Tag Protein, Human

$252.00 $280.00
Save 10%
No.2 Bestseller on lamcf.fr >

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EphA6 His Tag Protein, HumanProduct Specification Species Human Antigen EphA6 Synonyms Ehk2 Protein, Hek12 Protein, m ehk2 Protein Accession Q9UF33 Amino Acid Sequence Typ23 Val550, with C terminal 10*His

Product Specification


Species Human
Antigen EphA6
Synonyms Ehk2 Protein, Hek12 Protein, m-ehk2 Protein
Accession Q9UF33
Amino Acid Sequence

Typ23-Val550, with C-terminal 10*His WPGDCSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNWLRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLFYMESDESHGIKFKPNQYTKIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICSTGYEEIEGSCHACRPGFYKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGYFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSLIGVVRKDWASQNSIALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIITGLKPATKYVFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQILVGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 65-73kDa
Purity ＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1． Gitanjali Das, Qili Yu, Ryan Hui, Kenneth Reuhl, Nicholas W. Gale & Renping Zhou Cell & Bioscience volume 6, Article number: 48 (2016).

Background

Ephrin-a receptor 6, also known as EphA6 or EHK2, belongs to the Ephrin receptor subfamily of the protein tyrosine kinase family. The Eph family is the largest group of related receptor tyrosine kinases known, consisting of 16 members in the vertebrate genome. Eph receptor and its ligand ephrin play an important role in neuronal migration, axon binding and specific target guidance, dendritic spine formation and neuroplasticity. Studies have shown that EphA5 and EphA6 are significantly expressed in perinatal development and in the cerebral cortex of adult mice, so EphA5 and EphA6 play an important role in regulating the cellular structure of cortical neurons.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36668962063

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Asha77
Cuba, US
★★★★★ 3
Great taste but cannot use
Flavor Name: Spearmint, Size: 55 Count (Pack of 1)
First time trying for dental care. Really enjoy the taste only drawback taste doesn’t last long. However, it’s better than other sugar substitutes which my stomach does not like. Glad I signed up for the three pack sub. Great product! Recommend. May 16, 2026 Update: Unfortunately I cannot use this product after the initial trial every time I chew on these i experience stomach issues so the three pack I purchased will need to find someone that can use them or throw out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 6, 2026
O
Verified Purchase
OpinBook
Cuba, US
★★★★★ 5
Powerful lasting peppermint flavor & the xylitol fights plaque!
Flavor Name: Spearmint, Size: 55 Count (Pack of 6)
The gum has a powerful peppermint taste – very refreshing. The flavor lasts a long time. The main reason that I bought this gum is because it has 100% xylitol. Xylitol helps fight plaque buildup. I have only had the product one day, so I can't say that it works, but I read many reports before I bought the gum that xylitol is excellent for fighting plaque buildup. It also has no sugar. It's vegan and it has only five calories per two pieces. I have so far only chewed one piece at a time. One piece seems plenty for me. I've read that people need from six to ten grams of xylitol per day to effectively fight plaque. So, this gum needs to be chewed accordingly. Many people chew after every time they eat. I am happy with this purchase.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
C
Verified Purchase
C. Critchfield
Belleville, US
★★★★★ 5
Only protein shake I've found that doesn't cramp my stomach
Flavor Name: Chocolate, Size: 14 Fl Oz (Pack of 12)
I've tried the vanilla, strawberry and chocolate, and chocolate is by far the best. It's not too sweet (where as the vanilla and strawberry were). It doesn't have any extra whey concentrate or caseinate or soy or whatever added to it to boost protein. Brands that do that mess up my stomach, giving me bad stomach cramps. This is just highly filtered milk, and lactase enzyme that tackles the lactose sugar left behind after filtration. Maybe that's the secret. (I can drink normal milk and not get cramps. But, whey protein isolate and other things give me cramps.) This has become a go-to in a protein diet I'm on. I'll have one for breakfast with some coffee. That lasts me until lunch. If not, I'll simply have another 2 hours later. They're each less than 200 calories, so it's not too bad having another if it staves off hunger. I find I eat a smaller lunch. I might have another one for a mid-afternoon snack. Then I'll have a normal dinner. Basically I'm replacing bigger meals and a breakfast with 2-3 smaller calorie protein shakes. And the protein keeps me satisfied. (unlike something like slim fast that's just all sugar and ramps up your insulin). They're a bit pricey (almost $4/bottle). But, I'm cutting back on my grocery bill as well. So, it's balancing out. I figure I could be spending $12/day on fast food or some other garbage that makes me fat. Instead I'm drinking 2-3 of these a day, and am down 10lbs over a month. I'll stick with these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
P
Verified Purchase
Placeholder
Draper, US
★★★★★ 5
No Chalky Aftertaste!
Flavor Name: Chocolate, Size: 14 Fl Oz (Pack of 12)
I've tried many different kinds of protein drinks, and almost all of them have either an unpleasant consistency or aftertaste. This Core Power Chocolate Protein Shake is by far the best I have ever tasted. If you place your cold drink in the freezer for about an hour and a half before drinking, it becomes slushy like a real milkshake. It is delicious and high in protein. I drink one just about every day for a quick and easy lunch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
A
Verified Purchase
Andy A
Cuba, US
★★★★★ 5
still the best but a big price premium
Flavor Name: Chocolate, Size: 14 Fl Oz (Pack of 12)
Still the best tasting out there. drinking these is not a chore. easy open bottle. the price is the only thing, These are great for lunch replacement where you actually look forward to drinking it. every now and then my kids will get to them. it really is like a really good chocolate milk closer to a milkshake. but yea price is a touch excessive, but this protein level is the best price per gram after i ran the numbers compared to theor other products.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2026

recommand products

SO Green Tank w/ Daisy
10.00
Aluminum 17mm Wheel Hex Drive with Nuts and Pins
39.99
Cashmere Body Butter
28.00
F1Ultra R5 Micro Spring Set, Red, Yellow, Blue
13.95
Sweet Nothings Body Butter
28.00