SKU: 36864707516

FGFR3[K650Q] Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 2 - Sep 7

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

FGFR3[K650Q] ProteinProduct Specification Species Human Synonyms FGFR3[K650Q],FGFR3 Accession P22607 1 Amino Acid Sequence P436 T806(end)

Product Specification


Species Human
Synonyms FGFR3[K650Q],FGFR3
Accession P22607-1
Amino Acid Sequence

P436-T806(end)

PLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGEGCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKQTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSSSSSGDDSVFAHDLLPPAPPSSGGSRT

Expression System Baculovirus-InsectCells
Molecular Weight 67.8 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, 0.05% Brij35, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36864707516

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Donte Davis
Natrona Heights, US
★★★★★ 5
Simple Upgrade That Makes a Real Difference
Style: CF10140 Classic
Installed the Zezut cabin filter in my 2005 Infiniti G35 and noticed the difference immediately. The air inside the car felt fresher and cleaner right away — no more stale air circulating through the vents. The HEPA backing is a big deal, knowing it's actually filtering out dust, pollen, and particles rather than just being a basic filter gives you real peace of mind. The quality feels solid and well made. Installation was super easy, took just a few minutes with no tools needed. For the price this is one of those simple maintenance upgrades that's absolutely worth doing. Your lungs will thank you. Great price and affordable, top choice for replacement in my opinion.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
A
Verified Purchase
Andy...
Lake Worth, US
★★★★★ 4
Good filter.
Great filter works well .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
J
Verified Purchase
Joe
West Palm Beach, US
★★★★★ 5
Efficient long lasting. Great Value
Style: CF10735 Classic
These filters (my second one) has lasted me over two years with a little maintenance in between, (removing from time to time to vacuum and shake out the bigger debris.) They do a great job of keeping the cabin air really clean and fresh. 1) Over designed and built (Good thing) installed without effort. 2) Fit and finish is perfect for my 2016 Genesis G80 3) Carbon filter works well but after about six months it no longer absorbs orders, This is excepted especially when I have not swapped it out for over two years. 4) Great value and honestly I should be replacing these cabin filters out ever six months for efficiency and order control. Note: When I decided to replace it the filter held up structurally as the day I installed it. The charcoal beads where all intact as well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 30, 2026
R
Verified Purchase
RadcoCorp.
Birmingham, US
★★★★★ 5
Better than OEM, AC is so fresh now!
Style: CF10374 Classic, Style: CF10374 Classic
YEEEEEEAHHHHH! This went straight from the mailman's hand to my 2010 Tacoma. -Fits better than OEM and Replacements! -AC smells so fresh now! -Easy installation without any complications. -Has a foam gasket around the filter that makes it fit like a glove, thight and secure! -Very Well Made and quality materials. Won't be returning this one, will actually buy it for the rest of my cars! ⭐️⭐️⭐️⭐️⭐️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026
R
Verified Purchase
rose
Waukegan, US
★★★★★ 5
Exactly as pictured
I ordered this air filter for my car, it is exactly as described and pictured. The fit was perfect and the quality is worth the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2024

recommand products