SKU: 38466041447

Mouse TL1A/TNFSF15 Protein, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 30 - Sep 4

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse TL1A/TNFSF15 Protein, His tagProduct Specification Species Mouse Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, Tl1, Vegi Accession Q5UBV8 Amino Acid Sequence Protein sequence (Q5UBV8, Ile76 Leu252, with N His tag) ITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

Product Specification


Species Mouse
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, Tl1, Vegi
Accession Q5UBV8
Amino Acid Sequence

Protein sequence (Q5UBV8, Ile76-Leu252, with N-His tag) ITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 21.6 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Tnfsf15, also known as tumor necrosis factor - like weak inducer of apoptosis (TWEAK), is a member of the tumor necrosis factor (TNF) superfamily. It is a type II transmembrane protein that can be cleaved to release a soluble form. Tnfsf15 plays important roles in various physiological and pathological processes. It regulates cell survival, proliferation, and migration by binding to its receptor, Fn14. In the immune system, Tnfsf15 is involved in inflammation and immune cell activation. It also participates in tissue remodeling and angiogenesis. Dysregulation of Tnfsf15 has been associated with several diseases, including cancer, autoimmune diseases, and cardiovascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 38466041447

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Minerva Jayne Van Allen
Natrona Heights, US
★★★★★ 5
Perfect Squeaky Toy for My Exes Deranged Dog
Color: Multicolor, Color: Multicolor
My ex-beau and I are still friendly and we exchange Christmas presents. This year, I wanted to make sure that his utterly nutty and completely bonkers Aussie, Diego, got a new toy so that he has added enrichment in his enclosure. Diego really enjoyed this toy! A perfect size for him and a loud squeaker, which my ex will undoubtedly appreciate being squeaked non-stop while he is trying to game with his various assortment of video game people. Worth every penny. Diego’s smiling face is proof of his delight in his adorable Slothicorn. Squeak away, Diego! Squeak away!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2026
B
Verified Purchase
BarbaraAnn
Dallas, US
★★★★★ 4
Fun
Color: Multicolor
A little smaller than we'd hoped but all in all he's pretty cool and our dogs loved him.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 5, 2025
S
Verified Purchase
Siri Lynn Colomy
Houston, US
★★★★★ 5
Worth it!
Color: Llama
Wanted to keep this for myself! Made well, size is perfect for a 90 pound pup, durable enough for a non chewer (she cleans their fur but doesn’t chew anymore). Durable enough that has been left outside during Summer storms and washed/dryed a couple times already (I use a laundry bag) and still has its adorable shape. Great value for the money, though I might need to buy another one for myself! *^_^*
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 1, 2025
D
Verified Purchase
Danielle Cuddington
Alexandria, US
★★★★★ 5
Our Doodle's Fav Toy
Color: Multicolor
The first slothicorn toy that we received had a broken squeaker. We were able to quickly and easily get a replacement and send the broken one back. This is one of my pup's favorite toys, although I don't think the horn will last long-- it's the part she likes to chew on the most! At 5lbs, the toy is the same size as my Goldendoodle puppy. I think the toy is overpriced when not on sale (I got on Black Friday promo), so I would encourage waiting for a price drop before purchasing or locating another option that's affordable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 2, 2026
K
Verified Purchase
Kathy Sako
Lowell, US
★★★★★ 3
Not very durable if your dog likes to play aggressively with his toys.
Color: Shello There
My yorkie loves it. However he removed the rope tail tail on day one. Within a couple of days it came loose at the seem from chewing and he started pulling the stuffing out. I won't give back to him until I am able to mend it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026

recommand products