SKU: 39282079346

BCMA/TNFRSF17 His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 28 - Sep 2

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

BCMA/TNFRSF17 His Tag Protein, HumanProduct Specification Species Human Antigen BCMA TNFRSF17 Accession Q02223 1 Amino Acid Sequence Met1 Ala54, with C terminal 8*His MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAGGGSHHHHHHHH Expression System HEK293 Molecular Weight 15 19kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4 Reconstitution Reconstitute at 0. 1 1 mg ml

Product Specification


Species Human
Antigen BCMA/TNFRSF17
Accession Q02223-1
Amino Acid Sequence

Met1-Ala54, with C-terminal 8*His MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

15-19kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

BCMA (The B-cell maturation antigen), also designated as TNFRSF17, belongs to the tumor necrosis factor receptor superfamily, which is a family of cytokine receptors. BCMA is encoded by a 2.92-kb TNFRSF17 gene located on the short arm of chromosome 16 (16p13.13) and composed of 3 exons separated by 2 introns. There are four natural splice variants of human BCMA that present with different receptor binding affinities, membrane-anchoring ability, and intracellular domain signaling. BCMA main ligands are the cytokines B-cell activating factor and a proliferation-inducing ligand. The interaction between BCMA and its ligands activates the NF-κB signaling pathway that plays an important role in B-cell proliferation and maturation and is essential for the survival of long-lived bone marrow plasma cells. BCMA is expressed preferentially on mature B cells and has minimal expression on hematopoietic stem cells or other cell types. The BCMA has emerged as a central target in multiple myeloma (MM). In preclinical studies, overexpression of BCMA and the interaction with is ligand, a proliferation-inducing ligand (APRIL), was found to promote MM progression in vivo and augment MM cell growth and survival through induction of multiple signaling cascades, including protein kinase B (AKT), MAPK, and nuclear factor (NF)-κB. Additionally, BCMA has been shown to be solubilized at high levels in serum of patients with MM (sBCMA). This form of sBCMA binds to B-cell activating factor (BAFF). The role of BAFF is to stimulate normal B-cell and plasma cell development; however, this functioning is prevented when it is bound by BCMA in the serum, thereby leading to decreased polyclonal immunoglobulin levels in patients with MM.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39282079346

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LM
Carnegie, US
★★★★★ 5
Love, love, love my 30 C Max!!
Size: 03-30C Slim Max
OMG! This is one the single best purchases I've made! It's a life changer! I can wash dishes, walk the dog, do laundry, work on computer, workout, work in the yard, go shopping, etc., while vacuuming. I love the multitasking it provides. Saves so much time and my floors have never been so consistently cleaned. I wouldn't say I hate vacuuming, but I do dislike it enough that I didn't vacuum as much as I should've. I dreaded taking vacuum out of closet, getting arm and back fatigue/achiness then needing to wrap it up to store it away..... I truly thought the Eufy would be something I'd end up returning because of poor performance or because I would simply not like or use it. Wrong, wrong, wrong. I loved it from the very first use!.... Can't understand why I hadn't bought one long ago! Everybody needs one; they just don't know it!..... I named it 'WOW' because that's what I kept saying as I watched it clean my floor. It cleaned under my bed which alone made it a keeper! It's quiet, so much so, during first uses I searched for it thinking it had turned off/stopped working when actually it was working perfectly, I just couldn't hear it. I had to go into the room and stand near it to hear it. An equally important factor is it doesn't frighten my easily frighten dog which could have been a deal breaker (happy dog = happy life). She just looks at, occasionally will follow, it with curiosity or ignores it. Probably the best compliment is my husband (who often thinks a purchase is not needed/money wasted) having said my WOW was a good/useful buy. I was shocked! Think his exact words were, "Getting that was a good idea". When I asked him why he said that, he said because it's helpful and it does a good job..... Set up was super easy (I don't use app. One reason I chose this model is I wanted to use manual remote). The included accessories show Eufy's thoughtfulness which helps to put their vac over the top. (I plan to use only original replacement brushes, filters in appreciation and support for their offering a quality product at a great price) ..... I thought I wouldn't like the random movement and had strongly considered the 30G Edge (took me forever to decide b/w the two), but I find I really like the randomness. I feel it similarly patterns the way I'd normally vacuum (as well as it being normal needing to pick up cords, etc. , so to me that isn't a negative). The random pattern makes it quick. Can use remote if feel a spot was missed (which is why I wanted remote), but it does clean whole area - just set it and forget it. I now know the slow, streamline pattern of the 30G Edge would have been frustrating..... I could go on and on, e.g., drop sensors work flawlessly, spot cleaning helpful for entry rugs, empty/cleaning dust bin/filter is quick and easy, boundary strips have been helpful - only downside is strip packaged in a roll makes it not lay straight once unrolled (ends curl up); perhaps it could be in strips instead of a roll, and to ensure no damage, I chose to use painter's tape to attach strip to floor, and battery life good so far. I have always needed to turn it off before battery ran low because the floors were done. Once I let it continue to test the battery length, but it was taking so long I ended up turning it off after approximately an hour. It successfully finds dock, takes extra time if obstacles blocking its way..... To end a long review I will lastly say I feel the suction power is very adequate; leaves passage trails on carpet and evidential proof in the dust bin! Like others, I chose Eufy because of Anker's reputation, and because of the good customer service reviews. Thinking of getting a second one for upstairs... Love, love, love my 30C Max!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 23, 2021
J
Verified Purchase
Jen
Massapequa, US
★★★★★ 1
One year in- DONT DO IT :(
Size: 01-X10 Pro Omni Black, Size: 01-X10 Pro Omni Black
ONE YEAR IN REVIEW I have mixed thoughts because I really like it, the app is great, it cleans great. I’ve stayed on-top of all the maintenance the app has asked me to do and found replacement parts here and there as needed. I have it run everyday and it does a great job, works about as good as I could have imagined in terms of cleaning. Unfortunately exactly one year after purchasing it, 6 days after the one year warranty expired, I started having issues. For about a week I got the same error of “roller brush stuck”. I cleaned the brush, paid for replacement parts, followed every trouble shooting suggestion in the app, same error. Contacted support and did everything they told me to do in terms of trouble shooting. On Reddit I learned this is a common problem and probably from a motor issue. Worked with support for a few weeks and eventually they offered to repair it for me, even though it was a few days over the warranty. Super stoked with that. But had the weirdest interaction with the support people, felt like I was dealing with some like 3rd party questionable service, just not the interactions I expected for such a “high end” expensive product. Contacted them through the app, got an email response and they sent me a shipping label. I packed it up very well, wrapped it up, and sent it off for repair. Like two weeks later get it back on my doorstep, in the same box I sent it in, but all squished. Vacuum just set ontop of the same bubble wrap I sent it in, but like not wrapped or protected . Device was clearly beat up, everything in the box was wet and there were random parts scattered throughout the box and a panel missing from the top of the vacuum that wasn’t even in the box. Also just realized MULTIPLE parts are missing. I’m not only missing a random panel, but also a brush guard, filter and dust bin, all pieces that I sent in. I literally feel like I got scammed. So confused and disappointed. For like a $900 vacuum and only one year out, I’m disappointed to have had such a major issue so quickly and to have such an unprofessional experience with the service group. I’ve never seen something packed so poorly and was shocked, like actually dumbfounded to have found that parts are missing and like such an obvious one too, literally the panel on-top, I noticed it before the box was even open all the way. I couldn’t tell you if it worked or not because with exposed wiring and chips from the missing panel plus all the other missing parts, it literally cannot be used, it’s useless. No idea what to do now besides pray they sent me parts or just replace the thing. UPDATE: 40 something emails later I finally begged someone to send me a new device. Their original suggestion was for me to buy all the replacement parts they took and they would refund me 15% back, ridiculous in my opinion, but I literally cannot buy the most important part, the top panel that was stolen, it’s not something they sell. The “new” device they finally sent me was all scratched up with dirt, gravel, kitty litter and cat food scattered throughout the packaging. The vacuum was literally covered in the gravel and all scratched up. Clearly a returned device that was sent back dirty and no one cleaned it up before sending it to me. I thought it was all cleanable but the scratches were deep and one is right over the camera. I asked if I could exchange it and was literally told I should be grateful they sent me anything and they wouldn’t help me anymore… The customer service is so bad it’s just not worth it, get something else, save yourselves the struggle. Because of all this, I wouldn’t recommend this product. For the price, I’d expect it to last more than a year without a major repair issue needed (replacing the motor) and I’d expect better customer service and a better warranty. Stay away, it’s too expensive and too risky :(
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 28, 2025
P
Verified Purchase
Pamela J
Dallas, US
★★★★★ 5
Eufy 30C is MARVELOUS!
Size: 07-C30
I purchased this Eufy 30C after 6 months of chiding from my sister, who has one. Eufy - where have you BEEN my whole life! I have uneven saltillo tile floors in this home - I was sweeping floors nearly everyday just trying to keep the floors clean in this desert environment. On a daily basis, I just could NOT keep the floors clean enough for our barefoot habits. This vacuum cleans VERY well! I turn it loose every day - it cleans under furniture and beds, it cleans my lower-nap area rugs very nicely. I use the Auto mode (random cleaning pattern). The bumper is gentle on furniture legs and walls, the sweeper automatically goes into/out of baseboard cleaning - it cleans all along the walls! Most rugs I can leave in place and let the sweeper clean those, also. The few rugs that do get caught up in the brush, I just pick up before starting the cleaning. I have moved cords so they are permanently not in the way, so I only had to deal with those issues once. The suction on this vacuum is terrific - the combination of the spinning side brushes and the roller brush pick up everything. If the sweeper has been there, the area is spotless! It moves easily from floors to rugs. I normally run the sweeper as we are having breakfast - it is very quiet, although a little "rattling" as it moves across these saltillo tiles. I have used the daily programmed mode, but personally prefer to run it when I am "ready" (some rugs picked up). The vac does not ever seem to "miss" a room using this random pattern, and eventually it seems to get everywhere in a room. It just roams around the house and does it's thing - WITHOUT my help, and better job than I did on a daily basis! I have a large, heavy-nap area rug that I prefer to run the regular sweeper on once a week rather than have my Eufy waste sweeping power there. I placed the boundary strips under the very edges of that rug to keep the Eufy off. This works most times although, occasionally, Eufy finds his way onto that carpet, anyway. I have to remind myself, but I do use an upright sweeper on all the rugs and a canister sweeper for the tile about every one to two weeks. I empty the waste container everyday when cleaning is finished (I am always amazed at how much this sweeper "finds" and picks up!). I also clean the filters everyday with a small, battery powered hand vac (opposite the direction of airflow of the Eufy). This seems to remove the fine dust from the filter. I did purchase an additional filter set. Each week, I change the filter to a clean one, and wash out the used filter under running-spray tap water and let it dry. The filters are disposable pressed paper (and a small foam filter sheet that is also washable), but I have interchanged these two filters for 6 months and they are still working just fine. Emptying the waste container and cleaning/changing the filters is extremely easy and fast. I clean the roller brush of hair and carpet fuzz as needed. I have contacted the company with questions and they were extremely responsive. I also had the brush guard replaced from the company without any issues or questions at all. Customer service was very nice. (I believe the uneven tiles just wore on a very small rubber piece and it eventually came off. Looking back, I really don't believe it affected the performance of the sweeper, or the brush guard, at all. If it happens again, I probably will not bother to replace it). I cannot think of one dislike I have of this Eufy 30c. I believe the price was extremely reasonable for the excellent job it does. It has made a big difference in the attitude I have about this house as the one, most annoying, issue I had - seemingly constantly dirty floors - is now a non-issue. If this sweeper broke down tomorrow, I would have trouble getting another here fast enough!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 3, 2019
A
Verified Purchase
Amazon Vine Customer Review
Bozeman, US
★★★★★ 5
Awesome robo-vac/mop with rotating mop head/no pads.
Size: E25 Black
I owned a Narwal Freo for 1 year and it died right after the warranty period was up. Tried replacing the battery but that did not fix the issue so I had to purchase another one. I noticed this eufy had high reviews and the 1 star reviews seemed to be just isolated issues so I purchased this one. Right away I noticed that the instructions/setup was much more simple. Second this one has a big wide mop roller on the front and after mopping I didn't see the mop streaks in circular patterns on the floor like I did with the Narwal as it had two rotating mop heads on the front so the single mop roller seems to be a better solution. Setup consisted of removing protective wrappers off of the tanks and base station, filling up the clean water tank, installing the detergent bottle and plugging it in. Next I downloaded the app and connecting the vac/mop to my network. This was SIMPLE to say the least. From there I could have just clicked clean on the app and it would clean the entire house. However, mapping gives you more flexibility when planning your cleaning ritual. You can define no go zones and clean rooms in any order you choose. I have a shedding dog so I have a separate robovac to clean up the dog hair prior to vac/mopping. This is a MUST with any robovac/mop combo as the dog hair on the floor will mix with the water and detergent and eventually prevent the mop from doing a good job. It will make a mess in the bottom tray of the base station too. I learned this through experience and reading all the one star reviews from customers. Robovac only cleaners last a LONG time. I had one that is still working great for over 3 years. All I had to do was replace the battery so it doesn't have to pause the job to recharge. So the mapping only took 4 minutes and it was pretty accurate. After the mapping I defined the room boundaries and renamed the rooms. Next I sent it off to clean and it did a FABULOUS JOB! No streaks and the floors are clean. The noise level is really low and more quiet than the Narwal. The other thing I noticed is it didn't use up much water to rinse the mop while cleaning. The Narwal used a lot of water and I was always dumping dirty water and adding fresh. I will always have a robomop and robovac as they save me so much time by not having to do this job twice a week. Connectivity to my network is excellent as it's in a location far from the router. This vac/mop is a good value for the money if IT LASTS BEYOND 1 YEAR. I will update this review as necessary and if it fails right after the warranty period I will report and downgrade this review to 1 star. These companies need to learn the importance of reliability and correct these issues. When I first reviewed the NARWAL it had almost a perfect 5 star review from all customers. After the year was up and it failed that star rating went down to 3+ stars. Most reviews reported their robovac/mop just died like mine did after the warranty period. I downgraded my review and reported the issue. I'm hoping this one will last because at the moment I am VERY satisfied with it like most customers. This model has been on the market much longer at the time of purchase so I would suspect if there were any reliability flaws they would have been addressed and corrected by now. We shall see. At this time I highly recommend!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
L
Verified Purchase
LB
Alexandria, US
★★★★★ 5
Excellent Robot Vacuum, Especially for the Price
Size: 11S, Size: 11S
I have been an iRobot Roomba buyer since 2007. My last Roomba bit the dust this month, and I did a ton of research before buying a replacement. I went with the Eufy for a few reasons: price point, cleaning power, quietness, and sleek design. Price: Very reasonable. Almost reasonable enough that I'd consider getting another one for my second floor. For now I'll just carry it upstairs. Cleaning power: This thing sucks... It's suction is much stronger than my Roombas have had. It picks up so much dust and pet hair. We do a full vacuum every other week with my Dyson, so I think of the robot vacuum as a supplemental vacuum. I was shocked at how much was in the dustbin after it's inaugural cleaning! The picture attached to this is from that cleaning. It also gets a ton of dust in the little dust filter. In one of the video reviews I watched, the reviewer said it didn't pick up anything in that dust filter... So maybe my carpet is particularly dusty, because it has a thick layer after each cleaning. Quietness: I work from my home office, and this thing is quiet enough that I don't even turn it off during conference calls. This might be the thing I am most impressed with. My last Roomba was LOUD-- you couldn't even have a conversation with someone in the same room, let alone someone on speakerphone. Sleek design: I love/hate this. It definitely looks modern and cool, and more like an art piece than an appliance, but it shows all my finger prints, and now I keep a glasses cleaning cloth nearby so I can rub it down. I suppose if I only use the remote and never pick it up, this won't be an issue. A few considerations: I was hoping to find a robot vacuum that wouldn't eat my carpets' tassels, but I don't think that vacuum exists. I have only used the Eufy 4 times so far, and it doesn't always get its brushes wrapped around the long tassels, but it does sometimes. It seems to realize it sooner than my Roomba did at least. The Roomba would sometimes rip gobs of them off in a single cleaning. I try to tuck them under the edge of the rug and that doesn't seem to bother Eufy. It has pulled off probably 2 tassels so far. The cleaning pattern seems pretty random. I saw some other vacuums that chart out complex maps of your home, and Eufy doesn't seem to do that. But, it doesn't seem to matter, because it still hits every spot in the rooms. I'm a little concerned about durability. My Roombas ran for many, many years with easily replaceable parts. We'll have to see if Eufy has the same longevity. All in all- I'm very happy with my purchase and definitely recommend it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 7, 2018

recommand products