SKU: 39872430878

Human Tissue factor, his tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Tissue factor, his tagProduct Specification Species Human Synonyms Coagulation factor III,Thromboplastin Accession P13726 Amino Acid Sequence Protein sequence (P13726, Ser33 Glu251, with C 10*His) SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight

Product Specification


Species Human
Synonyms Coagulation factor III,Thromboplastin
Accession P13726
Amino Acid Sequence

Protein sequence (P13726, Ser33-Glu251, with C-10*His) SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFREGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 26.5 kDa Observed MW: 33-45 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Tissue factor, also called platelet tissue factor, factor III, or CD142, is a protein encoded by the F3 gene, present in subendothelial tissue and leukocytes. Its role in the clotting process is the initiation of thrombin formation from the zymogen prothrombin. Thromboplastin defines the cascade that leads to the activation of factor X—the tissue factor pathway. The F3 gene encodes coagulation factor III, which is a cell surface glycoprotein. This factor enables cells to initiate the blood coagulation cascades, and it functions as the high-affinity receptor for the coagulation factor VII. The resulting complex provides a catalytic event that is responsible for initiation of the coagulation protease cascades by specific limited proteolysis. Unlike the other cofactors of these protease cascades, which circulate as nonfunctional precursors, this factor is a potent initiator that is fully functional when expressed on cell surfaces.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 39872430878

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Brittany Frisbie
West Palm Beach, US
★★★★★ 5
Peanut Butter Bliss for Paws That Love to Gnaw
Flavor Name: Peanut Butter, Size: 2.19 Pound (Pack of 1)
Purina Busy Bone Peanut Butter Chews are like Netflix for your dog—entertaining, long-lasting, and slightly addictive. Made in USA facilities and crafted for small to medium breed adult dogs, this 10-count pouch delivers tail-wagging joy in every bite. Why It’s a Pup Pleaser: Peanut Butter Flavor: Irresistible to dogs and smells good enough to make you question your snack choices. Long-Lasting Chew Time: Keeps your dog busy while you Zoom, nap, or pretend to fold laundry. Made in USA Facilities: Quality you can trust, with standards that make tails wag and humans nod approvingly. Real-Life Perks: Great for dental distraction—helps reduce boredom and plaque with every chomp. No rawhide, no worries—just a safe, satisfying chew. Perfect size for small to medium dogs who think they’re large and in charge. Final Verdict: Busy Bone is the chew that turns your dog into a focused, peanut-butter-loving zen master. Whether you need a moment of peace or just want to treat your furry friend, this pouch packs the kind of joy that only a good chew can deliver.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 24, 2025
J
Verified Purchase
John D
Waukegan, US
★★★★★ 5
Excellent Treats for Small to Medium Dogs!
Flavor Name: Peanut Butter, Size: 2.19 Pound (Pack of 1)
I’ve purchased the Purina Busy Bone, Long Lasting Small/Medium Breed Adult Dog Chews, Peanut Butter Flavor - 10 ct. Pouch several times over the last few months, and they’ve become a staple in our dog’s treat routine! Our three dogs absolutely love them. The peanut butter flavor seems to be a huge hit, and I appreciate that these treats are made in USA facilities—I feel more confident in the quality and safety. They’re just the right size for small to medium breeds, and they last long enough to keep our pups occupied for a while. Plus, they don’t have that overpowering smell some chews do, and they don’t leave a mess behind, which is a big plus in my book. Overall, these are a high-quality, tasty, and reliable treat that keeps our dogs happy and busy. Highly recommend for any dog owner looking for a long-lasting chew that’s both delicious and made with care.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2025
D
Verified Purchase
Dawn
Waukegan, US
★★★★★ 5
Mr. Diggy approves two paws up
Flavor Name: Peanut Butter, Size: 5.25 Pound (Pack of 1), Flavor Name: Peanut Butter, Size: 5.25 Pound (Pack of 1)
These just arrived earlier today, and Mr. Diggy just had one a little while ago. Well, it was gone fast. He is 60 pounds and 14 years old and loves his treats so I make sure I have good ones for him because he can’t have that many. What a nice strong bone and you could smell the peanut butter. He was so excited he took it and went to lay down. He only does that with special things. I feed my dog and cats, Purina pro and I can see since they’ve been eating it that it agrees with them and makes their coats, soft and shiny besides. That’s why I bought these because they are made by Purina and there’s no rawhide I bought the larger bone and I’m glad I did. It’s a good size for him. They call him a medium sized dog, but they never tried to pick him up lol I am going to check now and see what other flavors they have although peanut butter is his favorite Try them I think your dog will like them. Mr. Diggy gives two paws up for these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
P
Verified Purchase
Precise Disarray
New York, US
★★★★★ 4
smells good, teething puppy loves gnawing on it as I hold it.
Flavor Name: Peanut Butter, Size: 2.19 Pound (Pack of 1)
I normally don't do treats like this, but my mom had purchased a small pack for my dogs. I was reticent to try it, but with a new puppy I was looking for something for little miss alligator teeth to chomp on that isn't my fingers. It worked out so well (I held it while she gnawed) that I purchased a big pack. While not meant for puppies, it has been working well for her to have something to grind her teeth on. Currently 10 weeks old, 20 lbs (a yellow lab) with super razor sharp teeth that is all about chomping on everything in her path. These slow her down for several minutes. She is blissed out as she works on it. Have to say, these arent super long lasting even with a tiny-ish puppy. But at least the price is good. We have had the original (pretty much no odor) and these peanut butter ones which even smell good to me! I may consider these again. Be mindful of calories! 343 calories a piece. Be mindful of their serving suggestion based on size of dog. This isnt meant to be a meal, and not meant for daily consumption. More of the rare treat style. Ingredients Rice, vegetable glycerin, wheat flour, water, brewers dried yeast, chicken by-product meal, hydrogenated corn syrup, sugar, corn germ meal, beef tallow preserved with mixed-tocopherols, pork, natural and artificial peanut butter flavor, partially hydrogenated vegetable oil, wheat gluten, phosphoric acid, salt, sorbic acid (a preservative), gelatin, calcium propionate (a preservative), BHA (a preservative), BHT (a preservative), calcium carbonate, citric acid.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 17, 2023
D
Verified Purchase
Doris Garvey
West Palm Beach, US
★★★★★ 5
Dogs love these
Flavor Name: Peanut Butter, Size: 5.25 Pound (Pack of 1)
My dogs absolutely love these and it kept them busy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products