SKU: 43307756399

Human MCM6, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 27 - Sep 1

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human MCM6, His tagProduct Specification Species Human Synonyms p105MCM Accession Q14566 Amino Acid Sequence Protein sequence (Q14566, Val676 Asp821, with C 10*His) VDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLEDGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 18. 2 kDa Observed MW: 25 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His

Product Specification


Species Human
Synonyms p105MCM
Accession Q14566
Amino Acid Sequence

Protein sequence (Q14566, Val676-Asp821, with C-10*His) VDEGAGGINGHADSPAPVNGINGYNEDINQESAPKASLRLGFSEYCRISNLIVLHLRKVEEEEDESALKRSELVNWYLKEIESEIDSEEELINKKRIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLEDGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 18.2 kDa Observed MW: 25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

DNA replication licensing factor MCM6 is a protein that in humans is encoded by the MCM6 gene. MCM6 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The MCM complex consisting of MCM6 (this protein) and MCM2, 4 and 7 possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre-RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication. Mcm 6 has recently been shown to interact strongly Cdt1 at defined residues, by mutating these target residues Wei et al. observed lack of Cdt1 recruitment of Mcm2-7 to the pre-RC.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43307756399

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 10 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gwen D.
New York, US
★★★★★ 5
It's one of the only toys that we originally got for our pup that has lasted
Color: Blue goose - pineapple plush
We got a lab mix (we think with a Great Dane) on Labor Day weekend 2025. She has destroyed 100% of the toys we got her that weekend, with the exception of this duck. Yes, it is missing it's feet at this point (they got chewed off and torn sometime around Halloween), but the duck itself is still intact. She chews on the duck every day, it's one of her favorite toys, and it's seen some things. We've washed it a few times in the laundry machine, and it looks nice a clean every time we pull it out and let it dry. She's gnawed on it through losing puppy teeth and getting adult teeth, and she's is currently chewing away on her duck on her bed in the living room. I understand others have reported really mixed reviews, but I'm so glad we got this duck and it's one of the only toys we've bought that I feel like was worth the price because it didn't get destroyed immediately. We plan on buying another one for Christmas.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 18, 2025
M
Verified Purchase
Mummy
Boise, US
★★★★★ 5
Honestly….
Color: Blue goose - pineapple plush, Color: Blue goose - pineapple plush
I hate to buy Giant or Tiny a toy only to find it in some corner ignored. Would this goose make a lifetime friend OR would it fly away to some unknown corner of the house?!?! I was thrilled that Giant wanted to open the box himself. As soon as I set it on the table for some pictures, Giant saw his chance and grabbed it. This happened again! Safe to say, our family gives this a FIVE!! This is great as it squeaks and crinkles. It is super soft cloth and states it can hold up to aggressive chewers. It is one foot long. The stitching all seems to be in place. They state it is "Upgraded Indestructible" as it is sturdier material. The last toy has lived up to that claim. QUALITY: 5 out of 5 PROS: For us, it's the crinkle sound. I'm not sure why but they love that sound. Easy wash and go is great too! CONS: I wish it was bigger than one foot but that is because I have a big dog. Overall, Fantastic toy that is always with a dog. I will need to purchase more to have hidden away should it ever get lost.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2026
E
Verified Purchase
EUP
Belleville, US
★★★★★ 3
“Indestructible” not so much
Color: Blue goose - pineapple plush
Cute as can be, but the cloth-only tips on the wings and tail were immediately ripped off, eaten, and vomited. I’m hoping without those, the toy will be “more” indestructible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
K
Verified Purchase
Kindle CustomerJoanne
Louisville, US
★★★★★ 4
He loved the toy
Color: Blue goose - pineapple plush, Color: Blue goose - pineapple plush
My dog loved this toy, however it is not indestructible, he had it in 2 pieces within a day, but I do need to say he is a big boy and we haven’t found a toy yet that he can’t destroy
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
L
Verified Purchase
LoriK
Carnegie, US
★★★★★ 2
Disappointed
Color: Platypus - pineapple plush, Color: Platypus - pineapple plush
3 month old husky mix ripped this toy open within hours of having it and as of now, all the feet are missing. I only let him play with it a few hours a day because of the squeaker, so not as advertised.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026

recommand products