SKU: 43390607490

PCSK9 His Tag Protein, Rat

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

PCSK9 His Tag Protein, RatProduct Specification Species Rat Synonyms PCSK9, FH3, PC9, FHCL3 Accession P59996 Amino Acid Sequence Gln31 Gln691, with C terminal 10*His

Product Specification


Species Rat
Synonyms PCSK9, FH3, PC9, FHCL3
Accession P59996
Amino Acid Sequence Gln31-Gln691, with C-terminal 10*His QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLERIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRLILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAARAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEEATVAAAICCRSRPSAKASWVHQGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 60-70kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Jaén R I. et al. (2022) Functional Crosstalk between PCSK9 Internalization and Pro-Inflammatory Activation in Human Macrophages: Role of Reactive Oxygen Species Release. Int J Mol Sci. 23(16): 9114.

Background

PCSK9 (proprotein convertase subtilisin-kexin type 9) is a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. PCSK9 undergoes an autocatalytic processing event with its prosegment in the ER and is constitutively secreted as an inactive protease into the extracellular matrix and trans-Golgi network. It is expressed in liver, intestine and kidney tissues and escorts specific receptors for lysosomal degradation. It plays a role in cholesterol and fatty acid metabolism. Atherosclerosis is a cardiovascular disease caused mainly by dyslipidemia and is characterized by the formation of an atheroma plaque and chronic inflammation. Proprotein convertase subtilisin/kexin type 9 (PCSK9) is a protease that induces the degradation of the LDL receptor (LDLR), which contributes to increased levels of LDL cholesterol and the progress of atherosclerosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43390607490

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Robert
Fort Morgan, US
★★★★★ 4
Where'd that cap go!?
This trimmer works well. I've looked over the one star reviews and I cannot imagine what those people were doing with their trimmers. I've had this device for three months or so. And I like it. It's quiet, and does a good job in your nose and ears. So after all that you're probably wondering why didn't you give it five stars? I marked it down one because of the shape., and maybe the height. Because they both contribute to this thing falling or being knocked over again and again and again. This devices base is less than an inch across and it about 5 inches high. I keep knocking it over just about any time my hand is anywhere near where it is. Because our fingers naturally curl, I keep knocking this thing over. And while that's not usually a big deal. It has a small cap that shoots off and runs under dressers, tables, chairs, just about anything with a space under it. Mine even went under the fridge one time and the stove on another occasion. I've decided not to let it get to me, because I like the functionality of the device. That five inch height makes it easy to hold on to. And if I wind up losing the cap. It won't matter.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 9, 2025
S
Verified Purchase
Stephan wilkinson
Dallas, US
★★★★★ 5
Pleasantly surprised..
This Nose, Facial & Body Trimmer is really a multipurpose product with all the benefits from all the attachments that are included. I am very pleased with how neat, clean, and smooth it leaves my skin. I can carry it with me on the go or use it from the comfort from my own home. I spray it with a tea tree and alcohol mix to keep it sanitized. I can give it a 4.5-star rating. The only suggestion I would make to make a really good product great is having a few more attachments that flexible . Love it! Katrina
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 20, 2025
M
Verified Purchase
michelle stokkers
San Leandro, US
★★★★★ 5
Nose trimmer
Works great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2025
L
Linda
Birmingham, US
★★★★★ 3
Detachable head???
I loved using this nose hair trimmer for a number of months......until I removed the detachable head. I cannot get the detachable head back onto the groomer... Any advice???
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2025
S
Verified Purchase
SJL
Belleville, US
★★★★★ 5
Perfect !
Works great! No more batteries. I ordered a green one for my husband.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2025

recommand products