Pay in installments of $67.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 28 - Sep 2
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
ROBO4 His Tag Protein, MouseProduct Specification Species Mouse Antigen ROBO4 Synonyms roundabout, axon guidance receptor, homolog 4 (Drosophila) Accession Q8C310 Amino Acid Sequence Leu28 Glu470, with C terminal 8*His
Product Specification
| Species | Mouse |
| Antigen | ROBO4 |
| Synonyms | roundabout, axon guidance receptor, homolog 4 (Drosophila) |
| Accession | Q8C310 |
| Amino Acid Sequence |
Leu28-Glu470, with C-terminal 8*His LDSPPQILVHPQDQLLQGSGPAKMRCRSSGQPPPTIRWLLNGQPLSMATPDLHYLLPDGTLLLHRPSVQGRPQDDQNILSAILGVYTCEASNRLGTAVSRGARLSVAVLQEDFQIQPRDTVAVVGESLVLECGPPWGYPKPSVSWWKDGKPLVLQPGRRTVSGDSLMVSRAEKNDSGTYMCMATNNAGQRESRAARVSIQESQDHKEHLELLAVRIQLENVTLLNPEPVKGPKPGPSVWLSWKVSGPAAPAESYTALFRTQRSPRDQGSPWTEVLLRGLQSAKLGGLHWGQDYEFKVRPSSGRARGPDSNVLLLRLPEQVPSAPPQGVTLRSGNGSVFVSWAPPPAESHNGVIRGYQVWSLGNASLPAANWTVVGEQTQLEIATRLPGSYCVQVAAVTGAGAGELSTPVCLLLEQAMEQSARDPRKHVPWTLEQLRATLRRPEGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-75kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1.Xiao, W., Pinilla-Baquero, A., Faulkner, J. etal. Robo4 is constitutively shed by ADAMs from endothelial cells and the shedRobo4 functions to inhibit Slit3-induced angiogenesis. Sci Rep 12, 4352 (2022).https://doi.org/10.1038/s41598-022-08227-8. |
Background
Roundabout homolog 4, also known as magic roundabout and ROBO4 is a member of the immunoglobulin superfamily and ROBO family.Roundabout 4 (Robo4) is a transmembrane receptor that expresses specifically in endothelial cells. ROBO4 contains two fibronectin type-III domains and two Ig-like C2-type (immunoglobulin-like) domains. ROBO4 is predominantly expressed in embryonic or tumor vascular endothelium and is considered important for vascular development and as a candidate tumor endothelial marker. ADAM10 and ADAM17 are abscisic enzymes of Robo4, and the negative regulation of their ligand Slit3 is a new control mechanism of Robo4 signaling in angiogenesis.
Protocol
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy