Pay in installments of $56.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 29 - Sep 3
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CD36/SR-B3 His Tag Protein, HumanProduct Specification Species Human Synonyms CD36, SR B3, SCARB3, BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV Accession P16671 Amino Acid Sequence Gly30 Asn439, with C terminal 10*His
Product Specification
| Species | Human |
| Synonyms | CD36, SR-B3, SCARB3, BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV |
| Accession | P16671 |
| Amino Acid Sequence | Gly30-Asn439, with C-terminal 10*His GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 74-84kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Forte E. et al. (2018) The interstitium in cardiac repair: role of the immune-stromal cell interplay. Nat Rev Cardiol. 15: 601-616. 2、Coraci I S. et al. (2002) CD36, a class B scavenger receptor, is expressed on microglia in Alzheimer’s disease brains and can mediate production of reactive oxygen species in response to -amyloid fibrils. Am. J. Pathol. 160: 101-112. |
Background
CD36 belongs to the scavenger receptor class B (SR-B), a family of highly glycosylated transmembrane receptors with a wide range of ligand recognition sites. It has been reported that glycosylation of CD36 is required for trafficking of intracellular CD36 to the cell surface membrane. Because of its wide range of ligands, CD36 has plenty of functions, including but not limited to recognizing and ingesting lipids, participating in the process of inflammatory response, signal transduction, and apoptosis. The expression occurs in monocytes/macrophages and microglia as well as various other cells and tissues, including microvascular endothelial cells, platelets, adipocytes, and the heart. CD36 promotes the podocyte injury in many kidney diseases including primary nephrotic syndrome, obesity-related glomerulopathy, and diabetic nephropathy. Moreover, genetic knockout or antagonist blockade of CD36 could alleviate kidney injury indicating that CD36 is a potential therapeutic target.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 18 reviews
Sort
Product Reviews
★★★★★ 3
Good concepts, but uneven depth
Format: Paperback
Some helpful prompt frameworks, but parts felt repetitive and a few sections stayed too high-level for advanced users. Beginners will likely benefit more than experienced practitioners. If you’re new to prompt engineering it’s a decent starting point; if you’re already building structured prompts daily, it may feel light.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2026
★★★★★ 5
Necessary book to actually get value from AI tools
Format: Kindle
If you don't know how to prompt AI models correctly, you're missing out on substantially better results. This book has literally everything I could have asked for, it's an awesome resource.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 21, 2024
★★★★★ 5
Excellent Primer
Format: Paperback
"Foundation of Information Security: A Straightforward Introduction" stands out as a premier selection in 2024's literary landscape, particularly for those with a keen interest in information security. Published by No Starch Press, the book immediately catches the eye with its geeky cover art, appealing to enthusiasts and professionals alike. Beyond its visual appeal, the book offers a tactile satisfaction; the paper quality strikes the perfect balance of texture, enhancing the physical reading experience, while the ink quality ensures readability without the risk of smudging.
Having meticulously combed through its contents, it's evident that this book serves as an indispensable tool for information security professionals. Its comprehensive coverage, combined with an accessible approach to complex topics, makes it a valuable asset for both newcomers and seasoned experts in the field. The book's engaging writing style and practical insights contribute significantly to its status as a favorite read of the year, underscoring its importance in the professional development of information security practitioners.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2024
★★★★★ 5
Great book, and very up to date.
Format: Paperback
Great book, and very up to date.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 8, 2025
★★★★★ 5
Great book
Format: Kindle
This is must read book for individuals who are interested in the cyber security field. As a newbie, this provides a solid foundation on the technological concepts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2024
recommand products
14k Yellow Gold 7mm White Freshwater Cultured Pearl AA Diamond Pendant XP1742PL
196.00
14k Yellow Gold 6x4mm Oval Emerald AAA Diamond Pendant
141.00
14k Yellow Gold 3-D Saxophone Pendant
160.00
14k Yellow Gold 6x4mm Oval Emerald A Diamond Pendant
139.00
14k Yellow Gold 7x5mm Oval Garnet Pendant
186.99