SKU: 47598436872

Human Tau, His Tag

Sale price$150.75 Regular price$167.50
Save 10%

Pay in installments of $41.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 29 - Sep 3

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Tau, His TagProduct Specification Species Human Synonyms Neurofibrillary tangle protein, Paired helical filament tau (PHF tau) Accession P10636 2 Amino Acid Sequence Protein sequence(P10636 2, Met1 Gln186 with C 10*His) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight

Product Specification


Species Human
Synonyms Neurofibrillary tangle protein, Paired helical filament-tau (PHF-tau)
Accession P10636-2
Amino Acid Sequence

Protein sequence(P10636-2, Met1-Gln186 with C-10*His)


MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Theoretical: 20.9kDa Actual: 29kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied.

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles. 

Background

The tau proteins (abbreviated from tubulin associated unit) are a group of six highly soluble protein isoforms produced by alternative splicing from the gene MAPT (microtubule-associated protein tau). They have roles primarily in maintaining the stability of microtubules in axons and are abundant in the neurons of the central nervous system (CNS), where the cerebral cortex has the highest abundance. Hyperphosphorylation of the tau protein (tau inclusions, pTau) can result in the self-assembly of tangles of paired helical filaments and straight filaments, which are involved in the pathogenesis of Alzheimer's disease, frontotemporal dementia and other tauopathies.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 47598436872

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Chelle
Los Angeles, US
★★★★★ 5
Great hose!
Style: Standard Grip, Size: 100ft, Color: Chartreuse
5 stars without hesitation. This Flexzilla Garden Hose 5/8 in. x 100 ft. is legitimately one of the best hoses I’ve used. It’s actually flexible like advertised, doesn’t fight you every time you move it around, and it feels way more durable than the cheap stiff hoses from big box stores. I honestly don’t understand a lot of the complaints, mine has held up great, doesn’t kink nearly as bad as others I’ve owned, and is super easy to coil up. Solid hose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
J
Verified Purchase
james e. warner
Alexandria, US
★★★★★ 5
If you want to buy your last hose then flexzilla is your hose.
Style: Standard Grip, Size: 50ft, Color: Chartreuse
O.K. if you are reading my review I can honestly say that I don't think anyone knows what they are buying with this hose like I do as Amazon has the record of when I bought 100 feet of this hose. Long Long Long term user=purchased in 2017. I used this hose today and it looks-feels-works like it did the day I hooked it up on my reel. So flexible you can use it for a tourniquet if required. Hot-cold it don't matter this hose is the best. I am 70 yrs. old and it is the best hose I ever used in my life. Buy this hose once and then be done. Never kinks and not to heavy when moving around. Buy some and get on with whatever work you need to wash and then roll it up and forget about it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
T
Verified Purchase
Twylla J. Cameron
Boise, US
★★★★★ 4
Hose kinks.
Style: Standard Grip, Size: 100ft, Color: Chartreuse
I bought this hose 2 months ago and really like how light it is and easy to pull around the yard. However, I am having a problem with it kinking all of the time. It is really frustrating to have to go back and straighten it out when I am watering.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
A
Verified Purchase
A. Edwards
Natrona Heights, US
★★★★★ 5
Excellent product.
Style: Standard Grip, Size: 50ft, Color: Chartreuse
I've dealt with many different brands of hoses, took into account quality and price. After many disappointing purchases I can finally say "I got the right one this time". It is exactly as advertised, lightweight, flexible and very easy to handle. You won't go wrong with Flexzilla garden hose!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
L
Verified Purchase
levi clark
Fort Morgan, US
★★★★★ 5
There is no substitute to Flexzilla Hose
Style: Standard Grip, Size: 100ft, Color: Chartreuse, Style: Standard Grip, Size: 100ft, Color: Chartreuse
I absolutely love this hose! I purchased roughly 300 feet last year for use in my garden. It's extremely light and durable when you are dragging it around. For the most part it is kink free. If there does happen to be a kink down the line, a quick tug fixes the problem. No leaks, no shrinkage. Easy to install on any hydrant. DEFINITELY compact compared to other heavy hoses. The best part, it's super easy to coil it back up and hang in the tool shed. So I ordered a couple more 100 footers. I will definitely buy more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026

recommand products