SKU: 48205645754

Rhesus macaque TNFSF15 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rhesus macaque TNFSF15 Protein, His TagProduct Specification Species Rhesus macaque Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B Accession F6S8F9 Amino Acid Sequence Protein sequence (F6S8F9, Leu72 Leu251, with N His Tag)

Product Specification


Species Rhesus macaque
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B
Accession F6S8F9
Amino Acid Sequence

Protein sequence (F6S8F9, Leu72-Leu251, with N-His Tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 22.1 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 48205645754

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michelle M
Cuba, US
★★★★★ 5
Fantastic Necklace Organiser
Color: White, Size: 2 Layers, 20 Hooks
This is a great necklace organiser It has helped me keep all my necklaces in order - putting gold on one tray and silver the other. Keeps them for getting all tangled up and looks super nice. Not to mention the slim design doesn’t take up much space. Love it!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
L
Verified Purchase
Lisko
Natrona Heights, US
★★★★★ 5
Great necklace organizer!
Color: White, Size: 2 Layers, 20 Hooks
This necklace organizer is perfect for keeping necklaces separated and in view. I was tired of having them tangled in my jewelry box and this does the trick. Plus it is very well made and looks lovely in my closet. I highly recommend this for people who want to keep their necklaces organized!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
Z
Verified Purchase
Zilly115
Whiting, US
★★★★★ 5
So pretty!
Color: White, Size: 2 Layers, 20 Hooks
I got the two drawer box. Very nice quality necklace organizer. Looks beautiful with all my necklaces in it. Versatile as well as it has compartment on the bottom so that when you pull the drawer out the longer necklaces stay contained. You can also hang more than one necklace on the little hooks. I feel this will provide superb protection for my jewelry even with travel. I wish I got this sooner! It is a beautiful way to display the necklaces but I keep mine in my dresser drawer and it fits perfectly.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
M
Verified Purchase
Michele Wagner
Waukegan, US
★★★★★ 5
Perfect storage for necklaces
Color: Black, Size: 2 Layers, 20 Hooks
I adore this necklace organizer. I have many necklaces that I was storing in the top of my jewelry box on little hooks, but when I close the box top, everyting would get tangled up. There were not enough hooks to accommodate my collection. With this box, I have it standing upright next to my jewelry box and with the clear lid, I can easily see all my necklaces right away when deciding which one I want to wear that day. I put all my favorites in the top drawer for easy access. The drawers pull out easily and nothing is tangled. I often switch the back drawer with the front to change things up. Construction feels well made.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 14, 2026
K
Verified Purchase
Kim
Cuba, US
★★★★★ 5
Love!!!!!!
Color: White, Size: 2 Layers, 20 Hooks
I absolutely love this necklace organizer case! I know it’s not real leather, but it feels like it is. It keeps my necklaces from tangling up and so far is doing a wonderful job. I am very happy with this purchase!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026

recommand products