Pay in installments of $29.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 26 - Aug 31
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
MFGE8 His Tag Protein, HumanProduct Specification Species Human Synonyms MFGE8, MFGM, SED1, MP47, MFG E8 Accession Q08431 Amino Acid Sequence Leu24 Cys387 with C terminal 8*His
Product Specification
| Species | Human |
| Synonyms | MFGE8, MFGM, SED1, MP47, MFG-E8 |
| Accession | Q08431 |
| Amino Acid Sequence | Leu24-Cys387 with C-terminal 8*His LDICSKNPCHNGGLCEEISQEVRGDVFPSYTCTCLKGYAGNHCETKCVEPLGLENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFDFIHDVNKKHKEFVGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELNGCANPLGLKNNSIPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYGNDQWLQVDLGSSKEVTGIITQGARNFGSVQFVASYKVAYSNDSANWTEYQDPRTGSSKIFPGNWDNHSHKKNLFETPILARYVRILPVAWHNRIALRLELLGCGGGSHHHHHHHH |
| Expression System | Baculovirus-InsectCells |
| Molecular Weight | 41-45kDa |
| Purity | >85% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Liquid |
| Storage Buffer | 20mM Tris, 500mM NaCl,10%Glycerol, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Oshima K. et al. (2002) Secretion of a peripheral membrane protein, MFG-E8, as a complex with membrane vesicles. Eur J Biochem. 269 (4): 1209-18. 2、Karen G. et al. (2022) High Levels of MFG-E8 Confer a Good Prognosis in Prostate and Renal Cancer Patients. Cancers (Basel). 14(11): 2790. |
Background
Milk Fat Globulin Protein E8 (MFGE8), also known as Lactadherin, MP47, breast epithelial antigen BA46, and SED1, which promotes mammary gland morphogenesis, angiogenesis, and tumor progression. MFGE8 also plays an important role in tissue homeostasis and the prevention of inflammation. It plays an important role in the maintenance of intestinal epithelial homeostasis and the promotion of mucosal healing. Promotes VEGF-dependent neovascularization. MFGE8 binds to the Integrins alpha V beta 3 and alpha V beta 5 and potentiates the angiogenic action of VEGF through VEGF R2. It reduces inflammation and tissue damage in a variety of settings. MFG-E8 functions as a bridge between phosphatidylserine on apoptotic cells and Integrin alpha V beta 3 on phagocytes, leading to the clearance of apoptotic debris.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy