SKU: 49473170787

Biotinylated PD-1 Avi&His Tag Protein, Human

Sale price$220.50 Regular price$245.00
Save 10%

Pay in installments of $61.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 25 - Aug 30

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Biotinylated PD-1 Avi&His Tag Protein, HumanProduct Specification Species Human Synonyms PD 1, CD279, SLEB2, PDCD1 Accession Q15116 Amino Acid Sequence Leu25 Gln167, with C terminal Avi & 8*His Tag LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQGGGSGLNDIFEAQKIEWHEHHHHHHHH Expression System HEK293 Molecular Weight 30 43kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Biotin Tag Avi Tag, His

Product Specification


Species Human
Synonyms PD-1, CD279, SLEB2, PDCD1
Accession Q15116
Amino Acid Sequence

Leu25-Gln167, with C-terminal Avi & 8*His Tag LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQGGGSGLNDIFEAQKIEWHEHHHHHHHH

Expression System HEK293
Molecular Weight

30-43kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Biotin
Tag Avi Tag, His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Ishida Y. et al. (1992) Induced expression of PD-1, a novel member of the immunoglobulin gene superfamily, upon programmed cell death. EMBO J. 11: 3887.

Background

Programmed death 1 receptor (PD-1), also known as CD279, is a type I transmembrane protein belonging to the immune regulatory receptor CD28 family. PD-1 is expressed on the surface of activated T cells, B cells, macrophages, myelocytes, and a subset of thymocytes. Mature human PD-1 consists of a 148 amino acid (aa) extracellular region (ECD) with one immunoglobulin-like V-type domain, a 24 aa transmembrane domain, and a 95 aa cytoplasmic region. The tail of the cytoplasmic region contains two tyrosine residues, forming the immune receptor tyrosine inhibitory motif (ITIM) and immune receptor tyrosine switching motif (ITSM), which are important for mediating PD-1 signaling. PD-1 has two ligands, PD-L1 and PD-L2, which are members of the B7 family. PD-L1 is expressed in almost all mouse tumor cell lines, whereas the expression of PD-L2 is more restricted and mainly expressed by DC and a few tumor lines.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 49473170787

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Beverly Weidman
San Leandro, US
★★★★★ 5
Works well
Color: Silver
Very sharp and efficient. The top was stuck when I first opened it and I got cut but it’s ok. They work well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
M
Verified Purchase
melissa
San Leandro, US
★★★★★ 5
Great quality! So much more than the regular disposable tinkle razors!
Color: Silver
So much better and higher quality than the usual disposable tinkle razors. I gave all my other tinkle razors away and will stick with this one!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
C
Verified Purchase
Christina Simon
Phoenix, US
★★★★★ 5
New Fave Dermaplane
Color: Silver
Love how heavy duty this product is and that the razors are replaceable. So much better than the cheap plastic dermaplane razors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
N
Verified Purchase
Natalie Ferlin
Draper, US
★★★★★ 5
happy
Color: Silver
great!! the blades are sharp and last much longer than disposable plastic ones
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
A
Verified Purchase
Alena Cooper
Houston, US
★★★★★ 5
Smoothest Dermaplane Session EVER!
Scent: For Sensitive Skin, Size: 2 Fl Oz (Pack of 1)
This stuff is MIRACULOUS! I also struggle with dermaplanning at home and much prefer to have a professional do it, but that’s too costly for me to do as often as I’d like. I won’t say using this made the results as good as a professional but it wasn’t far off! It literally transformed the entire at home experience! I also end up with my skin feeling dry and irritated and almost bumpy and I feel like I never get a close or smooth result and it takes forever. This cut the process down by about half the time, I had zero redness or irritation afterwards, my skin was silky smooth, and I had zero rough spots. It took a very small amount of product and I never had to add any extra. I left it on afterwards until I got in the shower because it felt so soothing on my face. I have experienced no breakouts after using this and I honestly feel like it helped repair some areas that always feel a bit rough on my face. I can’t recommend this enough! For the record, I have tried dermaplanning with a variety of regular face oils and those worked just as well as using nothing. So I was really doubtful that just because this was marketed for dermaplanning it would make a big difference. But it honestly made a massive difference! I really appreciate that I was able to purchase a smaller bottle at a reasonable price to try. Even though the small bottle will probably last forever I’ll definitely be ordering the big size when I’m out. I will forever purchase this stuff!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 8, 2025

recommand products