Human Galectin-3, His tag
SKU: 50602339356

Human Galectin-3, His tag

Sale price$90.00 Regular price$100.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Galectin-3, His tagProduct Specification Species Human Synonyms Gal 3, 35 kDa lectin, Carbohydrate binding protein 35 (CBP 35), Galactose specific lectin 3, Galactoside binding protein (GALBP), IgE binding protein, L 31, Laminin binding protein, Lectin L 29, Mac 2 antigen, LGALS3, MAC2 Accession P17931 Amino Acid Sequence Protein sequence(P17931, Met1 Ile250, with C 10*His)

Product Specification


Species Human
Synonyms Gal-3, 35 kDa lectin, Carbohydrate-binding protein 35 (CBP 35), Galactose-specific lectin 3, Galactoside-binding protein (GALBP), IgE-binding protein, L-31, Laminin-binding protein, Lectin L-29, Mac-2 antigen, LGALS3, MAC2
Accession P17931
Amino Acid Sequence

Protein sequence(P17931, Met1-Ile250, with C-10*His)
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMIGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:27.8kDa Actual:35kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Galectin-3 is a member of the lectin family, of which 14 mammalian galectins have been identified. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Galectin-3 (Gal-3) is also a member of the beta-galactoside-binding protein family that plays an important role in cell-cell adhesion, cell-matrix interactions, macrophage activation, angiogenesis, metastasis, apoptosis. Galectin-3 is increasingly being used as a diagnostic marker for different cancers. It can be screened for and used as a prognostic factor to predict the progression of the cancer. Galectin-3 has varying effects in different types of cancer. One approach to cancers with high galectin-3 expression is to inhibit galectin-3 to enhance treatment response.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50602339356

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 183 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
T. Bock
Chelsea, US
★★★★★ 3
Difficult/impossible to unscrew plastic cups (in order to recharge the vibrating/blinking device)
Color: Orange
Generally, I don't leave feedback on items purchased. However, in this case, I feel compelled to do so in hopes the mechanical engineers (of this product) will take my input to heart and ultimately modify it. First the pros... - I have 2 high-energy dogs (Jack Russell Terriers) who love their toys (e.g., chewing bones, tug-of-war, etc.) but usually get bored with them rather quickly. - This interactive PetDroid ball, however, keeps them busy for a long time. - In fact, my smaller dog (Max) knows its storage location and sits (as early as 6 AM) in front of the cabinet so that I give him "his ball". It keeps him busy for up to 1-2 hours at a time. - Max is literally addicted to the PetDroid ball... his determinant play with it makes me laugh all the time. Now, the cons... - After several days of play, the exterior looks chewed up quite a bit. That's no problem though. - Unfortunately, the interior "threads/grooves" of the two plastic cups (for closing/fasting) are very tiny. - Thus, after an hour-long hard play, it is almost impossible to unscrew the 2 plastic cups in order to recharge the interior device. - It appears the 2 cups somehow come off track and get realigned from the inside. - At that point, I cannot unscrew the PetDroid ball in order to recharge the device.... and without the blinking/vibration, this toy is no longer fun for play. - Ultimately, I had to place the bottom half of the ball into a vise and then use a plumbing wrench to untwist it. Proposed Solution: - Increase the size of the plastic cups' interior threads/grooves so that they won't get realigned/come off track. - This would mitigate the current dilemma of NOT being able to unscrew the ball in order to recharge it. In my view, this should be a relatively simple fix and significantly improve the durability of this product. Thank you for your time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2022
S
Verified Purchase
Scott L.
Waukegan, US
★★★★★ 5
Good fun and entertaining!
Color: Orange
A really fun interactive toy for your dog! It's pretty erratic and really gets him chasing it. The included soft cover was kinda hard to install and then it's hard to turn it off and on with the cover on, I feel like the cover didn't really improve it at all, sure it's louder without the cover but I feel like dog also likes it that way, he likes loud squeaky toys and this thing making a bunch of noise is appealing to him. We have mostly hardwood floors so it really gets moving, I'm sure on carpet it would be a bit quieter and maybe even a bit slower to move around but on hard smooth surfaces this things can really get zipping around abd get some speed to make him chase it. Overall a fun and entertaining toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 27, 2026
B
Verified Purchase
bill a.
Pawtucket, US
★★★★★ 5
Awesome
Color: Orange
Awesome Toy . My Jack is crazy over it. She usually get bored with others, but this toy still has her attention after a couple of weeks Runs a long time on a short charge. 👍🏻
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
C
Verified Purchase
Chad
Lake Worth, US
★★★★★ 2
Not the Fetch-Fest I Hoped For
Color: Orange
I had high hopes for the PetDroid Interactive Dog Ball, especially with the newly upgraded features and promises of durable, motion-activated fun. Unfortunately, it didn’t quite live up to expectations for my furry friend. Here’s why I’m giving it 2 stars. Promising Features, Lackluster Results The idea behind this toy is fantastic: a durable, motion-activated ball that would entertain my dog without much effort on my part. The ball is supposed to roll around on its own, keeping my dog engaged and active. However, in practice, it just didn’t capture my dog’s interest. Durability I will give credit where it’s due: the ball is well-made and seems durable. It can withstand some rough handling, which is great for more aggressive chewers. Unfortunately, durability doesn’t mean much if your dog won’t play with it in the first place. Motion Activation The motion activation feature is hit or miss. While the ball does move around as advertised, it didn’t seem to move in a way that intrigued my dog. He gave it a sniff, watched it for a minute, and then walked away, unimpressed. I tried multiple times to get him interested, but he simply wasn’t having it. Lack of Engagement The biggest issue is that the ball just didn’t engage my dog at all. It might be more suitable for a different personality type or breed, but for my pooch, it was a total flop. He’s usually quite playful and curious, so I was surprised by his lack of interest. Final Thoughts Overall, the PetDroid Interactive Dog Ball might work for some dogs, but it was a miss for mine. If your dog is easily entertained by automated toys, it might be worth a try. However, based on my experience, I can’t wholeheartedly recommend it. Pros: Durable construction Motion-activated as advertised Cons: Did not engage my dog Motion activation wasn’t intriguing enough Might be more suitable for specific dog types or personalities If you decide to give it a shot, just be prepared for the possibility that your dog might not find it as entertaining as you hope. For us, it’s back to the drawing board for a more engaging toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 14, 2024
S
Verified Purchase
Sally
Grantham, US
★★★★★ 4
Pup Loves It, Some Other Notes
Color: Orange
We've had this for about six months and my 75 lb, 14-month-old German Shepherd pup LOVES IT. Her favorite is "Crazy Bouncing Mode." In fact, she doesn't care much for the normal mode. She chews it a lot - even drops it in her water bowl at times - and it's still going strong. This is a great purchase. It's nice hands-off entertainment. Do know that it is heavy compared to a normal ball - if your pup likes dropping it on the ground like mine does, it will land with a hard "thud," even with the included sleeve. Hopefully you don't have downstairs neighbors. Also know that the cover that goes over the charging port is removable and your dog may choke on it if they chew it in just the right manner. Definitely only let the pup play with it while supervised. All in all, great toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 11, 2026

recommand products