SKU: 50848046917

EPHB2 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 3 - Sep 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPHB2 ProteinProduct Specification Species Human Accession P29323 Amino Acid Sequence K580 V987(end)

Product Specification


Species Human
Accession P29323
Amino Acid Sequence

K580-V987(end)

KLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG

Expression System Baculovirus-InsectCells
Molecular Weight 72.7 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 20mM Reduced Glu, 1mM DTT, 10% Glycerol, 0.05% Brij-35, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50848046917

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kindle Customer
Lake Worth, US
★★★★★ 5
Clear, Concise, and Compelling
Format: Kindle
The author takes us in an extraordinary trip through and about time. In particular, the discussion about Einstein’s Special and General Theories of Relativity were illuminating, clarifying a complex aspect of the nature of the universe. How should we think about time? This book will help the reader arrive at answers to that question.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2021
J
jh
Lowell, US
★★★★★ 5
Deep important and illuminating
Format: Kindle
Worth a second read. I keep going back to it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 2, 2023
A
Verified Purchase
Ashley's Novel Idea
Pawtucket, US
★★★★★ 5
Great plot, steamy goodness, and absolute heartbreak, what more could you want?
Format: Paperback
“I’d already concluded a long time ago that I would never love someone the way I’d loved Wren—the way I still loved her. Because it didn’t matter if it had been ten days or ten years. A love like that ruined you for all others.” Suspenseful, Heartbreaking and Surprising! I have only read one other Catherine Cowles book; Tattered Stars and I loved it just as much as I love Whispers of You. The thing I love about this book (and the other) is also my one complaint. She has found the magic potion for a perfect romantic suspense. And maybe I wouldn't be saying this, if I had finished the other series, before starting this. I also know my opinion is so limited having only read two out of her incredibly extensive backlist. BUT the two I have read, feel very similar to each other, So much so that I look back now, a week after reading Whispers of You and I am getting them confused in my head. Thats not to say I didn't LOVE both books, because I absolutely did. This just felt like a plug and play equation to perfection with changing the details around. That being said this book grabs you from the prologue and doesn't give your heart a break until the very end. Holt and Wrens story is heartbreaking, I do wish we would have gotten a glimpse of the good before the bad, more often through the book to further the draw between them. But that's not because I feel like its lacking, its more that I loved the love these two had for each other and I would have enjoyed seeing it before either of them suffered through the tainted lenses of loss and fear. I loved the side characters and as the story progressed, I began to wonder who the culprit was, I did have one right but was dead nuts wrong on the other so both my mind was blown, and my heart was broken at the same time when I found out. Catherine Cowles keeps your heart in a vice the entire story and I love her for that. I am new to romantic suspense but am prone to panic attacks (HA) so, I find that her writing is just enough and not too much for me to read without sending me in to a tizzy. Overall though I do love this book, and I look forward to Echos of you and the second one in Tattered and Torn series, I just think I might finish that series before I keep going so, I can keep them straight.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2023
L
Verified Purchase
Leigh
Los Angeles, US
★★★★★ 5
Stunning Second Chance Romance
Format: Paperback
Well, I truly began my February reading in the best way with this book. I was so excited to read it after absolutely loving the Tattered and Torn series and it DELIVERED my friends. It has all of the emotions, all of the beauty, all of the suspense I’ve come to adore in Catherine’s books turned up even just a little more. Dare I say she even turned up the spice a bit?? Phew with the heat between these two! Along with the suspense element we get served small town, an over protective hero, and the most heart melting of second chance romances. Right from the prologue this book is off and running, I was not prepared for it. You meet Wren and hear about her gorgeous love for Holt. An absolutely horrific event occurs though that we learn sends him running for 10 years, and makes her a ghost of her former self after losing him. Neither of them, especially Holt, handled the aftermath well. It made me love them more though to see the growth they go through when he comes back and they reforge their intense, soul deep connection. Both of them face a whole lot of demons. I also love that even though it was completely awful for them both to be apart, Holt leaving forces Wren to become independent and stand on her own. So their second time around, it’s an even stronger, more equal relationship. If you follow my feed closely, you also know that I am always gone for a found family dynamic, and we have that here in spades with the way the Hartleys watch out for Wren. Her relationship with Holt’s parents and siblings is just gorgeous. The way Holt heals his relationship with them all is wonderful too. I’m already deeply in love with Nash and cannot WAIT for his book next. Yes to a new family saga series, please and thank you!!! I can’t recommend this one enough.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 11, 2023
M
Verified Purchase
Miranda L
Natrona Heights, US
★★★★★ 4
Predictable
Format: Paperback
I found the villain of this one to be a little unbelievable. I still really enjoyed it but not my favorite
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2025

recommand products